KEGG   Felis catus (domestic cat): 101080656Help
Entry
101080656         CDS       T02385                                 

Gene name
NEU3
Definition
(RefSeq) sialidase-3 isoform X4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00511  Other glycan degradation
fca00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101080656 (NEU3)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101080656 (NEU3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101080656 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 101080656
NCBI-ProteinID: XP_006936987
Ensembl: ENSFCAG00000011939
UniProt: A0A2I2UWF4
LinkDB All DBs
Position
D1
AA seq 438 aa AA seqDB search
MEELGSREEVMEEVTSCSFSSPLFQQEDKRGITYRIPALLYIPPTHTFLAFAEKRSTSRD
EDALHLVLRRGLRTGHSVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVYLFFICVRGH
VTERQQIMSGRNAARLCFICSRDTGCSWSEVRDLTEEVIGAEVKRWATFAVGPGHGIQLQ
SGRLVIPAYAYYIPYWFFCFRLPCKAKPHSLMIYSDDLGATWHHGRLIQPMATVECEVAE
VTGRGGNPVLYCSARTPNRCRAEAFSDDRGECFQRLALSRELCEPPHGCQGSVVSFRPPE
ILRGCQDPNGKDASTIQQSPLLDRSLRLEQEAGTLSESWLLYSHPTCKKRRVNLGIYLNQ
TPLDAACWSHPWILHCGPCGYSDLAALEKEGLFGCLFECGTKRECEQIAFRLFTDREILS
HVHGDFTSPDKNPEPIES
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctggggtcccgtgaagaggtcatggaagaagtgacatcgtgctccttcagc
agccctctgttccagcaggaagacaagagagggatcacctaccggatcccagccctgctc
tacatcccccccacccacaccttcctggcctttgcagagaagcgctccacgagcagggat
gaggatgctctccacctggtgctgaggcgagggttgaggactgggcactcggtacagtgg
ggacctttgaagccactgatggaagccacattacctgggcatcggaccatgaacccttgt
cctgtgtgggagcagaaaagcggctgtgtatacctattcttcatctgtgtgcgaggccac
gtcaccgagcgtcagcagatcatgtcaggcaggaatgcagcccgcctctgcttcatctgc
agtcgagacactggctgttcatggagcgaggtgagggacttgactgaagaggttattggt
gcagaggtgaagcgttgggccacattcgctgtgggcccaggtcatggcatccagctacag
tcggggaggctggtcatccctgcatatgcctactacattccttactggttcttttgcttc
cggctaccatgtaaagccaagcctcattccctgatgatctacagtgatgacctaggggcc
acatggcaccacggcaggctcattcagcccatggcaacagtggagtgcgaagtggcagag
gtgactgggaggggtggcaaccccgtgctgtattgcagtgcccggacaccaaacaggtgc
cgggcggaggctttcagcgatgaccgtggtgaatgctttcagagactagccctgagccga
gagctctgtgagcccccgcatggctgccaaggcagtgtggtgagtttccggcccccggag
atcttacgtgggtgtcaggaccctaatggcaaagatgcttctaccattcagcagagccct
ctactggacagatcactaaggctagagcaagaagctggaacactgtctgaatcatggctc
ttgtactcacacccaacctgtaagaagcggagggtcaacttaggcatctacctcaatcag
acccccttggatgctgcctgctggtcccacccctggatcttgcactgcgggccctgtggc
tactctgatttggctgctttggaaaaggagggcttgtttgggtgtctgtttgaatgtggg
accaagcgagagtgtgagcagattgccttccgcctgtttacagaccgagagatcctgagc
catgtgcatggggacttcaccagccctgataagaaccctgagccaattgaaagctaa

DBGET integrated database retrieval system