KEGG   Felis catus (domestic cat): 101081899Help
Entry
101081899         CDS       T02385                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101081899 (GANC)
   00500 Starch and sucrose metabolism
    101081899 (GANC)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101081899 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101081899
NCBI-ProteinID: XP_003987296
Ensembl: ENSFCAG00000002897
UniProt: M3VZC6
LinkDB All DBs
Position
B3
AA seq 914 aa AA seqDB search
MEAAGKEEISVEDEAVDKNIFKDCSKIAFYRRQKQQLSTKSTYQALLDSATKGKDSTKFQ
ILNEATKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVVTSKPRTVRLISSSGDAGS
LVLADGKGDLKCHITANPFKVDLMSEEEVVMSINSLGHLYFEHLQVPLKKRATKENKEDT
SVDASQENQEDLGLWEEKFGKFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKPGRTLGIFWLNASETLVEINTEPAV
KYTLTQMGPVAAKQKVRSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGAQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRNKKRKLVVISDPHIKIDPDYSVYAEAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVREWYSSLFTFSAYQGSTDILYIWNDMNEPSVFRGPELTMQKNAIHHGNWEHREL
HNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGIPFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRQRYTLLPYWYSLFYRAHVAAEPVMRPLWIEFPEELNTFGVEDEYMLGSA
LLVHPVTEPKVTTVSVFLPGSNEVWYDSKTGAHWEGACTVKIPVTLDTIPVFQRGGSIVP
IKTTIGKSTGYMTDSPYGLRVALSTKGSAVGELYLDDGHSFQYLHQKQFLHRKFSFLSGV
LTNSCADKRGHHPSKCVVERVFVLGLKKQPSSVTTHSSDGKEEPVVFTYCTTMSTLSLEK
LSLNIGADWEVHIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctgggaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcagctctccacaaag
tccacctatcaggcattactagactccgccacaaaaggcaaagacagcaccaagttccaa
atcctcaatgaagcaactaaggttcctcttctggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaactcccctgaaacccaggtatgaagttcctgat
gttgtcacaagcaagccacgcacggtaaggctgatttcatcctcaggggatgcaggtagt
ctggtattggctgatggaaaaggagatctgaagtgtcatatcacagcaaacccattcaag
gtagatttaatgtctgaagaagaggttgtgatgagcataaactccctgggccacttgtac
tttgagcacctgcaagttcctctcaagaaaagagctaccaaagaaaataaggaggacaca
tcagttgacgcttctcaggaaaaccaagaggatctaggcttgtgggaggagaaattcgga
aaatttgtggatgtcaaagttaatggccctgcctccattggtttggatttctccttgcac
ggatttgagcatctttacgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggcgatgcttaccgtctttataatctggatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaaccaggcaggactcta
ggcattttttggctgaatgcctcagaaacactagtggagatcaatacagagcctgcagta
aagtacacactgacccagatgggccccgttgcagctaaacaaaaggtcagatctcgaact
gatgtgcattggatgtcagagagtggaatcattgatgtttttctgctgacaggacctaca
ccttctgatgttttcaagcagtactcataccttacaggcgctcaagccatgccccctctc
ttctctctggggtaccatcagtgccgctggaactatgaggatgagcaggatgtaaaagca
gtggatgcaggatttgatgagcatgacattccttatgatgtcatgtggctggacatagag
cataccgagggcaaaaggtacttcacctgggacaagaaaagattcccaaatcccaaaagg
atgcaagagctgctcagaaacaaaaaacgtaagcttgtggtcatcagtgacccccacatc
aagattgatcctgactactcagtgtatgctgaggccaaagaacagggcttctttgtgagg
aatcacgaaggaggagactttgaaggggtatgctggcctggtctctcctcttacctagat
ttcaccaatcccaaggtcagagagtggtattcaagtcttttcactttctctgcctatcag
ggatctactgacatcctctacatatggaacgacatgaatgagccctctgtctttagagga
ccagagctaaccatgcagaagaatgccattcatcatggcaattgggagcacagggaactt
cacaacatctatggtttttatcagcaaatggctactgcagaaggactgatacagcgatct
aaaggaaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgctgtgtggacaggcgacaacacggcagaatggagctacctgaaaatttctatccct
atgttactcaccctcagcattactgggatccctttttgtggagctgacgtaggtggcttc
attgggaatccagaagcagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccggggccacgctaccatgaacaccaagcggcgggagccatggctctttggggag
gaacacacccggctcatccgagaagccatcagacagcgctacaccctcctgccctattgg
tattctctgttctaccgggcacacgtggctgccgaacccgtcatgaggcctctatggata
gagttcccagaggaattaaacactttcggtgtggaagatgaatacatgctaggaagtgct
ttattggttcatccagtcacagaaccaaaagtcaccacagtcagtgtgtttctgccagga
tcaaatgaggtctggtatgactctaaaacaggtgctcattgggaaggagcatgtactgtg
aagatcccagtaactttggacactataccagtgtttcaacgaggtggaagtatagtgccc
ataaagacaactataggaaaatccacaggctacatgactgattccccatatggactccgg
gtggctctcagcactaagggttctgccgtgggtgaactctatcttgacgatggccattca
ttccagtacctccaccagaagcaattcttgcataggaagttttcgttcttgtcaggtgtt
ttgaccaacagttgtgctgacaaaagaggtcatcatcccagcaagtgtgtggtggagcgg
gtcttcgtccttggcctcaagaagcagccatcttctgtgaccacccattcatctgacggt
aaagaagagcctgtggtttttacatattgtaccacaatgtccaccctgagcctggagaag
ctgtcactgaacatcggcgctgactgggaggtccacatcaaataa

DBGET integrated database retrieval system