KEGG   Felis catus (domestic cat): 101082206
Entry
101082206         CDS       T02385                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04390  Hippo signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05200  Pathways in cancer
fca05218  Melanoma
fca05224  Breast cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082206 (FGF1)
   04014 Ras signaling pathway
    101082206 (FGF1)
   04015 Rap1 signaling pathway
    101082206 (FGF1)
   04390 Hippo signaling pathway
    101082206 (FGF1)
   04151 PI3K-Akt signaling pathway
    101082206 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101082206 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082206 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101082206 (FGF1)
   05218 Melanoma
    101082206 (FGF1)
   05224 Breast cancer
    101082206 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101082206 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101082206 (FGF1)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   101082206 (FGF1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101082206 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101082206
NCBI-ProteinID: XP_011281003
Ensembl: ENSFCAG00000009122
UniProt: A0A2I2U4K4
LinkDB
Position
A1
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacggccctgacggagaagttcaatctgcctcca
gggaattacaagaaacccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaatgaggaatgcttgttc
ctggaaaggctggaagaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aattggtttgtgggtctcaagaagaatggaagctgcaaacgcggtccccggactcactat
ggccagaaggcaattttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system