KEGG   Felis catus (domestic cat): 101082267Help
Entry
101082267         CDS       T02385                                 

Gene name
ALDH2
Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00053  Ascorbate and aldarate metabolism
fca00071  Fatty acid degradation
fca00280  Valine, leucine and isoleucine degradation
fca00310  Lysine degradation
fca00330  Arginine and proline metabolism
fca00340  Histidine metabolism
fca00380  Tryptophan metabolism
fca00410  beta-Alanine metabolism
fca00561  Glycerolipid metabolism
fca00620  Pyruvate metabolism
fca01100  Metabolic pathways
Module
fca_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101082267 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101082267 (ALDH2)
   00620 Pyruvate metabolism
    101082267 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101082267 (ALDH2)
   00561 Glycerolipid metabolism
    101082267 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101082267 (ALDH2)
   00310 Lysine degradation
    101082267 (ALDH2)
   00330 Arginine and proline metabolism
    101082267 (ALDH2)
   00340 Histidine metabolism
    101082267 (ALDH2)
   00380 Tryptophan metabolism
    101082267 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101082267 (ALDH2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101082267 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 101082267
NCBI-ProteinID: XP_003994722
Ensembl: ENSFCAG00000022000
LinkDB All DBs
Position
D3
AA seq 517 aa AA seqDB search
MFRAAASLGPRLGRRLLSAAATQAVPAPNQQPEVLFNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARDAFQWGSPWRRMDASDRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIIPG
FGPTAGAAIASHQDVDKVAFTGSTEVGHLIQIAAGSSNLKRVTLELGGKSPNIIMSDADM
NWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKSRVVGNPFDSQTEQGP
QVDKTQFQKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVIGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgccgctgccagtctcgggccccgcctgggccgccgcctcctgtcggccgcc
gccacccaggcggtaccggcccccaaccagcagcctgaagtcctcttcaaccagatcttc
ataaacaatgagtggcacgatgctgtcagcaggaaaacattccccaccgtcaatccatcc
actggagaagtcatctgtcaggtagctgaaggagacaaggaagatgtggacaaggcagta
aaggctgcccgggacgccttccagtggggctcaccctggcgccgcatggacgcatccgat
aggggccgcctgctgaaccgcctggctgatctgattgagcgggaccggacctacctggca
gccttggagacgctggataacggcaagccctacgtcatctcctacctggtggatttggac
atggtccttaaatgcctccgttattatgctggctgggctgataagtaccatgggaaaacc
attcccatcgatggggacttcttcagttatacccgccatgaacctgtcggggtgtgcggg
cagatcattccgtggaacttcccgctcctgatgcaagcctggaaactgggcccagccctg
gcgaccggaaacgtggttgtgatgaaggtggctgagcagactccactcaccgccctctac
gtggccaacctcattaaggaggctggctttccccctggtgtggtcaatattatccctgga
tttggccccacagctggggctgccatcgcctcccatcaggatgtggacaaagtagccttc
acgggctccactgaggttggccacctgatccagattgctgcagggagcagtaacctcaag
agagtgaccctggagctggggggaaagagccccaatatcattatgtcagatgcagacatg
aactgggccgtggagcaggcccactttgccctgttcttcaaccagggccagtgctgctgt
gcgggctcccggacctttgtgcaagaagatgtttatgctgagtttgtggagcggagtgtc
gcccgggccaagtctcgtgtagttgggaacccctttgacagccagacggagcaggggcca
caggtggacaaaactcagtttcagaaggtcctcggttatatcaaatctgggaaggaggag
ggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttcatccagccc
actgtgttcggagatgtgcaagacggcatgaccatcgccaaggaggagatctttgggcca
gtgatgcagatcctgaagttcaagaccatagaggaagtcattgggagagccaacaattcc
aagtatgggctggctgcagctgtcttcaccaaggacttggacaaggccaattatctgtcc
caagccctccaggctggcactgtgtgggtcaactgctatgatgtgtttggggcccagtca
ccgttcggaggctacaagatgtccgggaatggccgggagctaggagagtatgggctgcag
gcatacactgaagtgaaaacggtcacgatcaaagtgcctcagaagaactcctga

DBGET integrated database retrieval system