KEGG   Felis catus (domestic cat): 101082923
Entry
101082923         CDS       T02385                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04742  Taste transduction
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04929  GnRH secretion
fca04930  Type II diabetes mellitus
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca05010  Alzheimer disease
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082923 (CACNA1C)
   04020 Calcium signaling pathway
    101082923 (CACNA1C)
   04024 cAMP signaling pathway
    101082923 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101082923 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101082923 (CACNA1C)
   04929 GnRH secretion
    101082923 (CACNA1C)
   04912 GnRH signaling pathway
    101082923 (CACNA1C)
   04921 Oxytocin signaling pathway
    101082923 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101082923 (CACNA1C)
   04924 Renin secretion
    101082923 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101082923 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101082923 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101082923 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101082923 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101082923 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082923 (CACNA1C)
   04727 GABAergic synapse
    101082923 (CACNA1C)
   04725 Cholinergic synapse
    101082923 (CACNA1C)
   04728 Dopaminergic synapse
    101082923 (CACNA1C)
   04726 Serotonergic synapse
    101082923 (CACNA1C)
   04720 Long-term potentiation
    101082923 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101082923 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101082923 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101082923 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082923 (CACNA1C)
   05020 Prion disease
    101082923 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101082923 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101082923 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101082923 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101082923 (CACNA1C)
   05414 Dilated cardiomyopathy
    101082923 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101082923 (CACNA1C)
   04934 Cushing syndrome
    101082923 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101082923 (CACNA1C)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101082923 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101082923
NCBI-ProteinID: XP_023112367
Ensembl: ENSFCAG00000008541
LinkDB
Position
B4
AA seq 2227 aa
MLRAFVQPAAPAYQPLPRHPSAESEAKFKGTLVHEAQLNCFYIPPGGSNYGSPRAAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTISSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLII
IGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIMEKPAVEETKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSPYPNPENTGEDDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGXFLHKGSFCRNYFN
ILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIG
NIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRS
WENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYI
IIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQY
KVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKL
IAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITE
VNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPY
VALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIM
LACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYL
TRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKR
LVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLD
QVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIG
PEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTF
TTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPRPA
GYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRTHCYDVLGRCHSRESQIAMVCQEEVSQ
DETYDVKISEDTEYCSEPSLISTEMLSYQDDENRQLTPPEEDKRDIRQSPKRGFLRSASL
GRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPSTSPRPCA
TPPATPGSRGWPPQPIPTLRLEGAESNEKLNSSFPSIHCSSWSGEPTPCGGGGSTIRRAR
PVSLTVPGQAGAQGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIE
EMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAEGQEGETCAPTLACRKSEEELQDS
RAHVGSL
NT seq 6684 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctgctgcgcctgcataccagccgcttcccaggcaccct
tctgccgagtcagaggcgaagtttaagggcactttggtgcatgaagctcaactcaactgt
ttctacatccctcctggaggttccaactatgggagcccgcgtgcagctcacgccaacatg
aatgccaatgcggctgcggggctcgcccccgagcacatcccaacgcccggggcagccttg
tcctggcaggcagccatcgacgcggcccggcaggctaagctgatgggcagcgctggcaat
gcaaccatctccaccatcagctccacacagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcacgactgccacacgcccgccccgtgccctgctctgcctgactctgaag
aaccccatcaggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggttgtagggctttttagtgca
attttagaacaagccaccaaagctgatggggcaaatgctctaggaggtaaaggagctgga
tttgatgtgaaggcactgagggcattccgcgtgctgcgccccttgcggctggtgtctgga
gtcccaagtctccaagtcgttctgaattccattatcaaggccatggtccccctgctgcat
attgccctgttagtgctatttgtcatcatcatctacgctatcattggcctggagctcttc
atgggaaagatgcataagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggagactggccatgggcggcagtgccagaatggcact
gtgtgcaagcctggctgggacgggcccaagcacggcatcaccaactttgacaattttgcc
ttcgccatgttgacagtgttccagtgcatcaccatggagggctggacagatgtgctatac
tgggtcaatgatgccgtaggaagggactggccctggatctattttgttacacttatcatc
atagggtcattttttgtacttaacttggttctcggtgttcttagcggagagttttccaaa
gagagagagaaggccaaggctcggggagacttccagaagctgcgagagaagcagcagctg
gaagaggacctgaagggctacctggactggatcacccaggcagaggacatcgaccctgag
aacgaggacgaaggcatggatgaggagaagccccgaaacatgagcatgcccacaagtgag
accgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggagagaactgcggg
gccaggctggcccatcggatttccaaatcaaagttcagccgctactggcgtcggtggaat
cggttctgcagaagaaagtgtcgtgctgcagtcaagtctaatgtcttctactggcttgtg
atcttcctggtgttcctcaacacactcaccattgcctcagaacattacaaccagccccac
tggctcacggaggtccaagacacggccaacaaggcactactggcccttttcactgcggag
atgctgctaaagatgtacagcctgggcctgcaggcctactttgtgtccctcttcaaccgc
tttgactgcttcatcgtgtgtgggggcattctggagaccatcctggtggagaccaagatc
atgtctcccttgggcatctctgtgctgagatgtgtccggctactgcggatatttaaaatc
acaaggtactggaactccttaagcaacctggtggcatccttgctgaattctgtgcgctcc
attgcctccctgctgctactcctcttcctcttcatcatcatcttctccctcctggggatg
cagctctttggaggaaagttcaactttgatgagatgcagactcggaggagcacatttgat
aactttcctcagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgatgctgagagcctcacatctgcccaaaaggaggaggaa
gaagagaaggagagaaagaagctggccaggactgccagcccagagaagaagcaagagata
atggaaaagccagctgtggaggaaaccaaggaggagaaaattgagctgaaatccattaca
gctgatggagagtccccacccaccaccaagatcaacatggatgacctccagcccaatgaa
aatgaagataagagtccctaccccaacccagaaaatacaggagaagacgatgaagaggag
cctgagatgcctgtgggcccccgcccacgaccactctctgagctgcaccttaaggaaaag
gcagtgcccatgccagaagccagtgcatttttcatcttcagccccaacaacagatttcgc
ctccagtgccaccgcattgtcaatgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggcagctgaggaccctgtccagcacacctccttcaggaac
catattctgttttattttgacattgttttcactaccattttcaccattgaaattgctctg
aagatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatcctt
aagatgactgcttatgggngctttctacacaagggctctttctgccggaactacttcaac
atcttggacctgctggtggtcagcgtgtccctcatttcctttggcatccagtccagtgca
attaatgtggtgaagatcttgcgagttctgcgagtcctcaggcccctgagggccatcaac
agggccaaggggctaaagcacgtggtccagtgcgtgtttgtcgccatccggaccataggg
aatatcgtgattgtcaccacgctgctccagttcatgttcgcctgcatcggggtccagctt
ttcaagggaaagctctacacctgttcagatagttccaagcagaccgaggcggaatgcaag
ggtaactacatcacatacaaggatggggaagttgaccaccccatcatccagcctcgcagc
tgggaaaacagcaagtttgactttgacaatgttctggcagccatgatggccctctttacc
gtctccacctttgaggggtggccagagctgctgtaccgctccatcgactcccacacagaa
gacaagggccccatctacaactaccgtgtggagatctccatctttttcatcatctacatc
atcatcattgccttcttcatgatgaacatcttcgtgggttttgtcatcgtcaccttccag
gagcagggggagcaggaatacaagaactgtgaactggacaagaaccagcgacagtgtgtg
gaatatgccctcaaggcccggcccctgcggaggtacatccccaaaaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctactttgaatacctgatgttcgtcctcatcctg
ctcaacaccatctgcttggcaatgcagcactatggccagagctgcctattcaaaatcgcc
atgaacatcctcaacatgctcttcactggcctcttcactgtggagatgattctgaagctc
attgccttcaaacccaagggttactttagtgatccctggaatgtttttgacttcctcatc
gtaattggcagcataattgacgtcattctcagtgaaactaatcactatttctgtgatgca
tggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgag
gtaaacccagctgaacatacccaatgctctccctttatgaacgcagaggagaactcccgc
atctccatcaccttcttccgcctcttccgggtcatgcgactggtcaagctgctaagccgt
ggggagggcatccggaccctgctgtggaccttcatcaagtccttccaggctttgccctat
gtggcccttctgatagtgatgctgttcttcatctacgcagtgatcgggatgcaggtgttt
gggaaaattgccctgaatgacaccacagagatcaaccggaacaacaactttcagaccttc
ccccaagctgtgctccttctcttcaggtgtgccacaggggaggcatggcaagacatcatg
ctggcctgcatgccagggaagaagtgtgcccccgagtcagagcccagcaacagcacggaa
ggggaaacgccctgtggcagcagttttgccgtcttctacttcatcagcttctacatgctc
tgtgccttcctgatcatcaacctctttgtagctgtcatcatggacaactttgactacctg
acaagagactggtcaatccttggtccccatcatctggatgaatttaaaagaatctgggca
gagtatgatcctgaagctaagggtcgtatcaaacacctagatgtggtgaccctgctccgg
cggattcagcccccactgggttttgggaagctgtgccctcaccgcgtggcttgcaaacgc
ctggtctccatgaacatgcctctgaacagtgatgggactgtcatgttcaatgccaccctg
tttgccctagtccggacagccctgcggatcaaaacagaagggaacctagaacaagccaat
gaggagctgcgggccataatcaagaagatctggaagcgtaccagcatgaagctgctagac
caagtggtgccccctgcaggtgatgatgaggtcaccgttggcaagttttatgctactttc
ctgatccaagagtacttccggaaattcaagaagcgcaaagagcagggccttgtgggcaag
ccttcccaaaggaatgccctgtccttgcaggctggcttgcgcacgctgcatgacattggg
cctgagatccgacgggccatctctggagatctgacagctgaggaggagctggacaaggcc
atgaaggaggctgtgtctgctgcctccgaagatgacatcttcaggagggccggtggcctg
ttcggcaaccacgtcagctactaccaaagcgacggccggagcgccttcccccagaccttc
accacccagcgcccactgcacatcaacaaggcgggtaacagccaaggcgacaccgagtcg
ccatcccacgagaaactggtggactccaccttcacccccagcagctactcgtccactggc
tccaacgccaacatcaacaatgccaacaacactgccctgggccgcttcccccgtcccgct
ggctaccccagcgcagtcagcaccgtggagggccatgggccccccttgtctcctgctgtc
cgggtacaggaggcagcatggaagctcagctccaagaggacacattgctatgatgtgctg
ggacggtgccactcccgggagagccagatagccatggtgtgtcaggaggaggtctctcag
gacgagacctatgacgtgaagataagtgaagacactgagtactgcagcgagcccagcctg
atctccacagagatgctctcctatcaggatgatgaaaatcggcaattaacaccaccggag
gaggacaagagagatatccggcaatctccaaagaggggcttcctccgctctgcctcacta
ggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaagggggagac
atctctcagaagacagtcctgcccttgcatctggttcatcatcaggcattggcggtggca
ggcctgagccccctcctccagagaagccattcccccagcacatcccccaggccctgtgcc
accccaccagccactccaggcagccgaggctggcccccacagcctatccccaccctgcgg
ctggagggtgccgaatccaacgagaaactcaacagcagcttcccgtccatccactgcagc
tcctggtctggggagcccacaccctgtggtggaggtggcagcaccatccggagagcccgg
ccagtgtccctcactgtgcccggccaggctggggcccagggcaggcagttccacggcagt
gccagcagcctggtagaagcggtcttgatttcagaaggactggggcagtttgctcaagat
cccaagtttattgaggtcacaacccaggagctggctgacgcctgtgacatgaccatagag
gagatggagaacgccgcagacaacatcctcagtgggggcgcccagcagagccccaatggc
accctactacctttcgttaactgcagggacccagggcaggacagagcagagggccaagag
ggcgagacctgcgcgcccaccctggcgtgtcggaagagcgaggaggagctccaggacagc
agagcccacgtcggcagcctgtag

DBGET integrated database retrieval system