KEGG   Felis catus (domestic cat): 101083107
Entry
101083107         CDS       T02385                                 

Gene name
CD3D
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain isoform X1
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101083107 (CD3D)
   04660 T cell receptor signaling pathway
    101083107 (CD3D)
   04658 Th1 and Th2 cell differentiation
    101083107 (CD3D)
   04659 Th17 cell differentiation
    101083107 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101083107 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    101083107 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101083107 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    101083107 (CD3D)
   05162 Measles
    101083107 (CD3D)
   05169 Epstein-Barr virus infection
    101083107 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101083107 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101083107 (CD3D)
CD molecules [BR:fca04090]
 Proteins
  101083107 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 101083107
NCBI-ProteinID: XP_003992512
Ensembl: ENSFCAG00000011774
UniProt: M3WFR0
LinkDB
Position
D1
AA seq 170 aa
MEHSSFLAGLILSVLLSQVSPYKISVEELEDKVLLSCNTSIIRMEGTMGTLFRNDTNLDL
GKRILDPRGVYTCKRPDEQDKIPYTQVYYRMCQNCVELNSGTLAGIIIGDIIATLFLALG
VYCFAGYETGRLSEAADTQALLGNDQLYQPLRDRNDAQYSHLGENWPRKK
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaacactccagttttctggccggcctgatactgtctgtccttctctcccaagtgagt
ccctacaagatatccgtggaggaactggaggacaaggtgttgctgagttgtaacaccagc
atcatacggatggagggaacgatgggaacgctattccgcaacgatacaaatctggacctg
ggaaaacgcatcctggacccacgaggagtgtatacgtgcaagaggccagacgaacaagac
aagataccttacacgcaagtatattatcgaatgtgtcagaactgtgtggaactgaactca
ggcaccctggccggcatcatcatcggggacataatcgccactcttttcctcgctttgggg
gtctattgctttgcgggatatgagaccggaaggctctctgaggctgctgacactcaagct
ctcctgggaaatgaccagctctatcagcccctgcgagatcggaatgatgctcagtacagt
catcttggtgaaaactggcctcggaagaagtga

DBGET integrated database retrieval system