KEGG   Felis catus (domestic cat): 101083227Help
Entry
101083227         CDS       T02385                                 

Gene name
GALNT17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00512  Mucin type O-glycan biosynthesis
fca01100  Metabolic pathways
Module
fca_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101083227 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fca01003]
    101083227 (GALNT17)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101083227 (GALNT17)
Glycosyltransferases [BR:fca01003]
 O-Glycan biosynthesis
  Mucin-type
   101083227 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101083227
NCBI-ProteinID: XP_011288639
Ensembl: ENSFCAG00000015348
UniProt: M3WMF2
LinkDB All DBs
Position
E3
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVQKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgctggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggcggccaaccttagcgcgcacagcgccagccccatccag
gatgcggtcttgaagcgcctctcgctgctcgaggacatcgtctaccggcaactgaatggc
ttatccaaatcccttgggctcatcgaaggttatggtggacggggcaaagggggccttccc
gctaccctttccccggccgaagaagaaaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgcaaggaactgaagtactccaaggagctgccccagatctccatcatattcatcttc
gtgaacgaggccctgtcagtgatcctgcggtcagtccacagcgcggtcaaccacacgccg
acgcacctgctgaaggaaatcatcctggtggacgacaacagtgacgaagaggagctgaag
gccccgctggaagagtacgtccagaagcgctaccctgggctggtgaaggtggtacgcaac
caaaaaagagagggcctgatccgagctcgcatcgagggctggaaggcggccactggccag
gtcactggcttcttcgatgcccacgtggaattcacagctggctgggccgagccggttctg
tcccgaatccaggagaaccggaagcgagtgatcctcccgtccatcgacaacatcaaacag
gacacgttcgaggtgcagcgctacgagaactcggcccacggctacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccctctctccccatc
aggacaccagccatgattggctgctccttcgtggtcaacaggaagttctttggtgaaatc
ggtctccttgaccctggcatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtatggctctgtgggggcagcatggaggtcctgccttgctcacgggtggcccacattgag
cggaagaagaaaccctacaacagcaacatcggtttctacaccaagaggaatgctctccgg
gttgctgaggtctggatggatgattacaagtctcacgtgtacatagcgtggaatctgcca
ctggagaatccaggaattgacatcggtgatgtctccgaaagaagagccttgaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccacgtttacccagaaatgagaagatac
aataacaccattgcatatggggagcttcgaaacaacaaggctaaagacgtctgcttggac
caggggccactggagaaccacacagcaatactgtacccatgccatggctggggaccccag
cttgcccgctataccaaggagggcttcctgcacttgggagccctggggaccaccacgctc
ctccctgacacccgctgcctggtggacaactccaagagtcggctgccccagctcctcgac
tgtgacaaagtcaagagcagcctgtacaagcgctggaatttcatccagaacggagccatc
atgaataagggcacggggcgctgcctcgaggtggagaaccggggcctggctggcatcgac
ctcatcctccgcagctgcacgggacagaggtggacgattaagaactcgatcaagtag

DBGET integrated database retrieval system