KEGG   Felis catus (domestic cat): 101083762Help
Entry
101083762         CDS       T02385                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101083762 (TGM3)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101083762 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101083762
NCBI-ProteinID: XP_003983800
Ensembl: ENSFCAG00000014443
LinkDB All DBs
Position
A3
AA seq 694 aa AA seqDB search
MTALEPQSINWQVTSNRQAHRTDRFSGQQLTVRRGQPFSFSMILNRSLDSRDSLGFVAST
GPYPSESARTKAVFPLSSGISRGGWSAQLVSNKDNVLTISISSPANAPIGWYTLSTQISS
QGNDFIQKLGTFILLFNPWVQEDGVFMSNHAEREEYVQEDAGIIYVGSTNRIGMVGWNFG
QFEEGILDICLSILDHSLNFRRDPATDVARRSDPKYVGRVLSAMVNGNDDNGVISGNWSG
SYTGGRDPRNWNGSVEILKEWKRSGFRPVRYGQCWVFAGTLNTVLRSFGIPSRVVTNFNS
AHDTDRNLSVDVYYDAYGRPMDKGSDSVWNFHVWNEGWFVRTDLGPSYGGWQVLDATPQE
RSQGVFQCGPASVTAVREGDVNLDFDMPFVFAEVNADRITWIHDARNNTQKQNSTDARSI
GRYISTKAVGSNSRMDITEKYKYPEGSSQERQVFEKALGKLKPRMAFGATSARHLEREGR
EPSISGKFKVTGILEVGKEVNMALILKNLTSDMKTVTVNMTAWTIVYNGTLVHEVWKDSV
TISLDPEEEIQHPVKITYAQYEKYLKADNMIRTTAVCQVSDEAEVVVERDIILDNPSLTL
EVLDQARVQQPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLRIDVPTLRPKERSRVRF
EILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacggctttagaaccccagagtatcaactggcaggtgacctccaaccggcaggcgcat
cgcacagacaggttttccggccagcagctcaccgtgcgcagaggccaacccttcagcttc
tccatgatcttgaaccgaagtcttgacagcagagacagtctgggcttcgtagcctccaca
gggccttacccctcagagtcggccaggacaaaggctgtgtttccgctctccagtgggata
agtcgtggtggctggagcgcacagctcgtgtccaacaaggacaatgttctgaccatctcc
atctctagtcctgccaatgcgcccatcggatggtacacgctgagcacccagatctcctcc
cagggcaatgacttcattcagaaacttgggacgttcatactgctctttaacccctgggtg
caagaggatggtgtctttatgagcaaccacgcggagagagaggagtacgttcaggaagat
gccggcatcatctatgtggggagcacaaatcgaattggcatggtcggctggaacttcggg
cagtttgaagaaggcatcctggacatttgcctctcaatcctggatcacagcctgaatttc
cgtcgggaccctgctaccgacgtggcccgcagaagcgaccccaaatacgtcggccgagtg
ctgagtgccatggtcaacggcaatgatgacaacggtgtgatctctgggaattggagcggc
agctacacgggtggccgggacccacggaactggaatggcagcgtggagatcctcaaggag
tggaaaaggtctggcttcaggccagtccgatatggccagtgctgggtctttgctgggacc
ctcaacacagtgctgcggtctttcgggattccctcccgggtggtcaccaacttcaactcg
gctcatgacacagaccgaaacctcagcgtggacgtgtactatgacgcctatgggagaccc
atggacaagggcagtgatagcgtgtggaatttccacgtctggaacgaaggctggtttgtg
cggactgacctgggcccctcgtacggtggatggcaggtcctggacgccaccccccaggag
aggagccaaggggtgttccagtgcggccccgcttcggtgaccgccgtgcgagagggtgac
gtgaacctggacttcgacatgcccttcgtcttcgcggaggtgaacgccgaccgcatcacc
tggatccacgacgcccgcaacaacacccagaagcagaattccacggacgcccgcagcatc
ggcaggtacatcagcaccaaggccgtgggcagcaactctcgcatggacatcacggagaag
tacaagtatccagaaggttccagccaggagagacaagtgtttgagaaggctttggggaaa
cttaaaccccgcatggcttttggtgccacgtctgcgagacacttggaaagagaggggagg
gagcccagcatctctgggaagttcaaggtcactggcatcctggaggtgggcaaagaagtc
aacatggccctgatactcaaaaacctgacgagcgacatgaagacggtgaccgtgaacatg
acggcctggaccatcgtctacaacggcacactggtacacgaagtgtggaaggactctgtc
acaatatccctggatcccgaagaagaaatacagcatcccgtgaagattacatacgctcag
tacgagaagtacctgaaggcagacaacatgatccggaccaccgccgtgtgccaggtctcc
gacgaggcagaggtggtggtagaaagggacatcatcctggacaaccccagcctgaccctg
gaggtgctggaccaggcccgggtgcagcagcccgtgaacgtccagatgctcttctccaac
ccgctggatgagcccgtgaaggactgcgtgctgatggtggagggcagcggcctgctgctg
ggaagcctcaggattgacgtgccgaccctgcgccccaaggagcggtcccgggtgcgtttt
gagatcctgcccacccggagtggcaccaagcagctgctcgctgacttctcctgcaacaaa
ttccctgcaatcaaggccatgctgtccatcgacgtggccgaatga

DBGET integrated database retrieval system