KEGG   Felis catus (domestic cat): 101083873Help
Entry
101083873         CDS       T02385                                 

Gene name
ALPI
Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00730  Thiamine metabolism
fca00790  Folate biosynthesis
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101083873 (ALPI)
   00790 Folate biosynthesis
    101083873 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083873 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101083873 (ALPI)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101083873 (ALPI)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101083873 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Enzymes
  101083873 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101083873
NCBI-ProteinID: XP_023115573
Ensembl: ENSFCAG00000026278
LinkDB All DBs
Position
C1
AA seq 534 aa AA seqDB search
MQGAWVLLLLLGLRPQLSLGTIPVEEEDPAFWNRQAAQALDAAKKLKPIQTAAKNLILFL
GDGMGVPTVTATRILKGQINNKLGPETPLAMDHFPYVALSKTYNVDRQVPDSAGTATAYL
CGVKANYQTIGLSAAARFDRCNTTQGNEVVSVMYRAKKAGKSVGVVTTTRVQHASPAGTY
AHVVNRNWYSDADMPAKARKEGCQDIAQQLISNVDIDVILGGGRKYMFPKGTPDPEYPSD
ATQNGIRLDGRNLVQEWQARHQGARYVWNRQALLQASQDPSVTHLMGLFEPGDTKYEVHR
NHTRDPSLMEMTEAALHLLRRNPRGFYLFVEGGRIDHGHHDGRAYLALTEAVMFDSAIDK
ASQLTSEKDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPRKAHDNKTYTSILYGNGPGGF
ALKDGPRPNVSDRESGDPSYQQQAAVPLQSETHGGEDVAVFARGPQAHLVHGVQEQSFVA
HVMAFAACLEPYTDCGLPPSAGPSDAAPPGPAAGPPSLPLLAGALSLLLAGAAP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcctgggtgctgcttctgctgctgggcctgaggccacagctgtcccttggc
accatcccagttgaggaggaggacccagccttctggaaccgccaggcagcccaagccctg
gatgccgctaagaagctgaagcccatccagacggctgctaagaacctcattctcttcttg
ggggacgggatgggggtgcccacggtgacagccactcggatcctaaaggggcaaattaat
aacaaactgggacccgagacgcccctggccatggaccactttccgtatgtggctctgtcc
aagacatacaacgtggacagacaggtgccagatagcgcaggcacagccacagcctacctg
tgcggggtcaaggccaactaccagaccattggactgagtgcagctgcccgctttgaccgg
tgcaacacaacacagggcaacgaggtcgtctccgtgatgtaccgggccaagaaagcaggg
aagtccgtgggggtggtgaccaccacaagagtgcagcacgcctcgccagccggcacctac
gcgcacgtggtcaaccgcaactggtactcagacgcggacatgcccgccaaggcccggaag
gaggggtgccaggacatcgcccagcagctcatctccaacgtggacattgatgtgatcctg
ggcggaggccgaaagtacatgtttcccaaggggacgccagaccctgagtatccgagtgac
gccacacagaacggaatcaggttggatgggcgcaacctggtgcaggagtggcaggccagg
caccagggtgcccggtacgtgtggaaccgccaggcgctccttcaggcttcccaggacccc
tccgtaacacacctcatgggcctctttgagccaggagacacgaaatacgaggtccaccga
aaccacacccgggacccatccctgatggagatgacggaggcggccctgcacctgctgagg
aggaacccccggggcttctacctgtttgtggagggaggccgcatcgaccacggtcatcac
gacggcagggcttatctggcactgacggaggccgtgatgttcgattctgccatcgacaag
gccagccagctcacgagcgagaaggacactctgacccttgtcaccgctgaccactcccac
gtcttctcttttggtggctacacgcttcgaggcagctccattttcggcctagccccccgc
aaagcccatgacaacaagacctacacctccatcctatacggcaacgggcccggcggcttc
gcgctcaaggacggcccgcggcccaacgtcagcgacagagagagcggggacccctcgtac
cagcagcaggccgcggtgcccctgcagtccgagacccacggcggcgaggacgtggcggtg
ttcgcgcgcggcccgcaggcgcacctggtgcacggcgtgcaggagcagagcttcgtggcg
cacgtcatggccttcgccgcctgcctggagccctacaccgactgcggcctgccgccctct
gccggccccagcgacgccgcgcccccgggcccggccgccggcccgccgtcgctgcccctg
ctggcgggggcgctgtcgctgctgctggcgggcgccgcgccctga

DBGET integrated database retrieval system