KEGG   Felis catus (domestic cat): 101085453Help
Entry
101085453         CDS       T02385                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04972  Pancreatic secretion
fca04974  Protein digestion and absorption
fca05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085453
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    101085453
   04974 Protein digestion and absorption
    101085453
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101085453
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101085453
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101085453
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101085453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Toxin_4
Motif
Other DBs
NCBI-GeneID: 101085453
NCBI-ProteinID: XP_003983171
Ensembl: ENSFCAG00000018949
UniProt: M3WP64
LinkDB All DBs
Position
A2
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPIDDDDKIVGGYTCRRNSVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEHNIAVSEGSEQFINSAKVIRHPRYNANTIDNDIMLIKLSSPATLN
SRVSAISLPKSCAPSGSQCLISGWGNVQSLGEKYPDVLQCLKAPILTDSACRKAYPGQIT
SNMICLGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGAGCAQKGKPGVYTKVCNYVSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgctctcctgggagctgctgtggctttccccattgatgat
gatgacaagatcgttgggggctacacctgtcggaggaactctgtcccctaccaggtgtcc
ctgaactcgggctaccacttctgtggcggctccctcatcaattcccagtgggtggtgtct
gcggctcactgctacaagtcccgaatccaggtgcgtctgggagaacacaacattgcagtc
tctgagggcagtgaacaattcatcaattcggccaaggtcatccgccacccgagatacaat
gcaaacactattgataatgacatcatgctgattaaattgagctcacctgccaccctcaac
tctcgagtgtctgctatctctctgccaaaatcttgtgcaccttctggttcccagtgcctc
atctctggctggggaaatgtccagagccttggggaaaaatatcccgatgtcctgcagtgt
ctgaaagctcccatactaactgacagtgcttgccgtaaagcctacccaggccagatcacc
agcaacatgatctgtctgggcttcctggaaggcggaaaggactcttgccagggtgactct
ggtggccctgtggtctgcaacaaccagctccagggcattgtctcctggggtgccggctgc
gctcaaaaaggcaaacccggtgtctacaccaaggtctgcaactacgtgagctggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system