KEGG   Felis catus (domestic cat): 101085707Help
Entry
101085707         CDS       T02385                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04080  Neuroactive ligand-receptor interaction
fca04972  Pancreatic secretion
fca04974  Protein digestion and absorption
fca05164  Influenza A
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101085707
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101085707
   04974 Protein digestion and absorption
    101085707
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    101085707
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101085707
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101085707
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101085707
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101085707
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101085707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 101085707
NCBI-ProteinID: XP_003983172
Ensembl: ENSFCAG00000011878
UniProt: M3WFX9
LinkDB All DBs
Position
A2
AA seq 247 aa AA seqDB search
MTPLLILAFVGAAVAFPTDDDDKIVGGYTCEENSIPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEHNIEVLEGDEQFINSAKVIRHPRFNSWTLDYDIMLIKLSSPAALT
GQVSTISLPSACAPAGTQCLISGWGNTLSSGTNYPELLQCLDAPLLSQDQCKAAYPGQIT
ENMVCAGFLEGGKDSCQGDSGGPVVCRGELQGIVSWGYGCAQKNKPGVYTKVCNFTDWIK
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactccactcctgatccttgctttcgtgggagctgctgttgctttccccactgacgac
gatgacaagatcgttgggggctatacctgtgaggagaactccatcccctaccaggtgtcc
ctgaactcgggctaccacttctgcggcggctccctcatcagtgaccagtgggtggtgtct
gcggctcactgctacaagtctcgcatccaagtgaggctcggagagcacaacatcgaagtc
ctggagggggatgagcagttcatcaactcggccaaggtcatccgccaccccagatttaac
agctggaccctggactatgacatcatgcttatcaagctctcctcacctgcagccctcact
ggccaggtgtccaccatatcgctgccctccgcctgtgcccccgccggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcaccaactaccccgagctgctacagtgc
ctggacgccccgctgctgagccaggaccagtgtaaagccgcctaccccgggcagatcacg
gagaacatggtttgcgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtctgcagaggagagctccagggcatcgtctcctggggctatggctgt
gcccagaagaacaagcctggcgtctacaccaaggtgtgcaacttcacagactggattaag
gagacgatagctgccaacagctaa

DBGET integrated database retrieval system