KEGG   Felis catus (domestic cat): 101086359Help
Entry
101086359         CDS       T02385                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101086359 (GAA)
   00500 Starch and sucrose metabolism
    101086359 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101086359 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101086359 (GAA)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101086359 (GAA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101086359 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101086359
NCBI-ProteinID: XP_003997308
Ensembl: ENSFCAG00000008245
UniProt: A0A2I2V4D1 M3W981
LinkDB All DBs
Position
E1
AA seq 952 aa AA seqDB search
MDARWPLCCRPLLGAYILVSLATAALLGHVLLHDFLLVPQEQHGFSQVAEGLYRARQQGA
GHPDPQAPPGHHGSPRAAPTRCDVPPNSRFDCAPDKAITQEQCEARGCCYVPAGQWPRVP
RMGQPWCFFPPSYPSYKLHNLTTTETGYTATLTRATPTFFPKDILTLRLDVLLETESRLH
FTIKDPANRRYEVPLETPRVRSRASSTLYSVDLQEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQHITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLV
LEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDMYIFLGPEPKSVVRQYLEVVGS
PFMPPYWGLGLHLCRWGYTSTAVTRQVVENMTRAHFPLDTQWNDLDYMDARRDFTFNKDG
FGDFPAMVQELHRSGRHYVMIVDPAISSSSPPGSYRPYDEGLRRKVFITNDTGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLEN
PPYVPGVVGGTLRAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNDLHSLPQEPYRFSETAQRAMRKALALRYRLLPHLYTLFHRAHVGG
ETVARPLFLEFPEDPRTWAVDRQLLWGAALLITPVLEAGKVEVTGYFPAGTWYDLQTVPA
EALGSLPPPPPAPVTPAIHSRGQWVTLPAPLDTINLHLRAGHIIPLQGLGLTTTESRKQP
MALVAALTTNGEARGELFWDDGESLETLERGAYTQVVFLAKNNTVVNELVHVTSEGAGLQ
LRKATVLGVAAAPKQVLSNGVPVSNFTYSPDTKTLDIPVSLTMGEQFVISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgaggtggccgctgtgctgccgccccctgctgggggcctacatcctcgtgtcc
ctggccaccgctgccctcctggggcacgtcctgctccatgatttcttgctggtcccccaa
gagcagcatggcttctcccaagtagctgaggggctttatcgagctcgccagcagggagcc
ggccacccagacccccaggcccccccaggccaccacggcagtcccagagcagctcccaca
cggtgcgacgtgccccccaacagccgcttcgactgcgccccggacaaggccatcacccag
gagcagtgtgaggcccggggctgctgctacgtgcctgccgggcagtggcctcgggtcccc
cgcatgggacagccctggtgcttcttcccacccagctacccgagttacaagctgcacaac
ctgaccaccacggagacaggctacacggccaccctgacccgcgccaccccaaccttcttc
cccaaggacatcttgaccttacgcctggacgtgctgctggagactgagagtcgactccac
ttcacgatcaaagatcccgccaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cgcagccgggcctcatccacactttacagcgtggacctccaggaggagcccttcggggtg
gtcgtgcgccggaagctggacggccgggtgctgctgaacacgacggtggcccccctgttc
tttgctgaccagtttctgcagctgtccacctctctgccgtcccagcacatcacgggcctg
gccgagcatctcggctccctgatgctcagcaccaactggaccaagatcaccctgtggaac
cgggacatcgcccccgagcccaacgtgaacctgtacgggtcccaccccttctacctggtg
ctggaggacggcggcctggctcacggggtcttcctgctgaacagcaatgccatggacgtg
gtcctgcagccgagcccggccctcagctggcggtccacgggtgggatcctggacatgtac
atcttcctgggccctgagcccaagagcgtggtgcggcagtacctggaagtcgtgggctcc
ccattcatgccgccctactggggcctggggctccacctctgccgctggggctacacctcc
acggccgtcacccgccaggtggtggagaacatgaccagggcccacttccccctggacacg
cagtggaatgacctggattacatggacgcgaggagagacttcactttcaacaaggacggc
ttcggggacttcccagccatggtgcaggagctccaccggagcggccggcactacgtgatg
atcgtcgatcctgccatcagcagctccagccctcctggcagctaccgaccttatgacgag
ggtctacggaggaaggttttcatcaccaatgacaccgggcagccactgattgggaaggtg
tggcccggatttaccgccttccccgacttcaccagccccgaggcccttgactggtggcag
gacatggtggctgagttccacgcccaggtgcctttcgacggcatgtggatcgacatgaac
gaaccatccaacttcgtcaagggctctgtggacggctgccccgacagtgacctggagaac
ccgccctacgtgccaggggtggttggcgggaccctgcgggcagccaccatctgtgcctcc
agccaccagttcctctccacgcactacaatctgcacaacctgtacggcctgacagaagcc
cttgcctcccacagggccctggtcaaggctcgggggacgcgccccttcgtgatctcccgc
tcgaccttcgcgggccacggccgatacgccggccactggacaggggacgtgtggagcagc
tgggagcagctgtcctactctgtgccagaaatcctgctcttcaacctgctgggggtgccg
ctggtcggggccgatgtgtgcggcttcctgggcaacacgtcggaggagctgtgtgtccgc
tggacccagctgggggccttctacccgttcatgcggaaccacaacgacctccacagcctg
cctcaggagccgtacaggttcagcgagacggcgcagcgagccatgaggaaggccctcgcc
ctgcgctacaggctgctgccccacctgtacacgctgttccaccgggcccacgtggggggc
gagaccgtggcccggcctctcttcctggagttccccgaggacccccgcacctgggccgtg
gaccgccagctcctgtggggagcagctctgctcatcaccccggtgctcgaggccgggaag
gttgaagtgaccggttacttccccgctggcacatggtacgacctgcagacggtgccagca
gaggccctcggcagcctcccgcctccgcctcccgcacccgtcacgcctgccatccacagc
aggggacagtgggtgacactgccagccccactggacaccatcaacctccacctccgggcc
gggcacatcatccccctgcagggccttggcctcacaaccacggagtcccgaaagcagccc
atggccctggtcgcagccctgaccacgaacggggaggcccgaggagagctgttctgggac
gacggggagagcctggagacgctcgagcgtggggcctacacacaggtcgtcttccttgcc
aagaataacaccgtcgtgaacgagctggtgcacgtgaccagcgagggggccggcctgcaa
ctgaggaaggccaccgtcctgggggtggccgcggcccccaagcaggtcctctccaatggc
gttcccgtctccaacttcacctacagccctgacacgaagaccctggacatccctgtctca
ctgacgatgggagaacagtttgtcatcagctggtcttaa

DBGET integrated database retrieval system