KEGG   Felis catus (domestic cat): 101087020
Entry
101087020         CDS       T02385                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00330  Arginine and proline metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04146  Peroxisome
fca04371  Apelin signaling pathway
fca04926  Relaxin signaling pathway
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05133  Pertussis
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05152  Tuberculosis
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101087020 (NOS2)
   00330 Arginine and proline metabolism
    101087020 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101087020 (NOS2)
   04066 HIF-1 signaling pathway
    101087020 (NOS2)
   04020 Calcium signaling pathway
    101087020 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101087020 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101087020 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101087020 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101087020 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087020 (NOS2)
   05014 Amyotrophic lateral sclerosis
    101087020 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101087020 (NOS2)
   05152 Tuberculosis
    101087020 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101087020 (NOS2)
   05145 Toxoplasmosis
    101087020 (NOS2)
   05140 Leishmaniasis
    101087020 (NOS2)
   05142 Chagas disease
    101087020 (NOS2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101087020 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 101087020
NCBI-ProteinID: XP_019673046
Ensembl: ENSFCAG00000009214
LinkDB
Position
E1
AA seq 1156 aa
MREGLGAACEAARPRLCRLLRRILRPQPAFGPRRASLVTQDDPKCHGLSKHRNEPPQSLT
GIVKTVPESLRKLDMPPSACPRHVRIKNWGSGMTFQDTLHHKAKGDLACRSKSCLGAIMN
PKSLTRGPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYATNNGNIR
SAITVFPQRSDGKHDFRIWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYGR
FDVVPLVLQADGGDPELFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEML
NYVLSPFFYYQVEAWKTHIWQDEKRRPRRRKIPFKVLVQAVLFASMLMRKTMASRVRATI
LFATETGKSETLARDLGALFSCAFNPKILCMDQYGLSNLEEEQLLLVVTSTFGNGDSPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPTGEGDE
LSGQEEAFRSWAVQTFKAACETFDVRGKHRIQIPKLYTSNVTWDPHHYRLVRDSQPLDLN
KALGSMHAKNVFTMRLKSQRNLQSAKSSRTTLLVELSCEDSHRLSYLPGEHLGVFPGNQL
ALVKGILERVVDGPAPHQPVHLETLSESGSYWVRDKRLPPCSLSQALTYFLDITTPPTQL
LLRKLAQLATEEAERQRLEILCQPSEYNKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLP
ILKPRYYSISSSRACAPTEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFV
RSAGGFQLPEDPSRPCILIGPGTGIAPFRSFWQQRLHDAEHKGLRGSRMTLVFGCRRPDE
DHLYREEMLEMAQKGVLHEVHTAYSRLPGQPKVYVQDILRQQLASEVLRVLHKEQGHLYV
CGDVRMARDVAQTLKHLLAATLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDGA
ARQPSDPRVPAAHGTS
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcgcgaggggctgggtgccgcgtgcgaggccgcccggccccggctctgccggctcctc
cgcaggatcctgcggccgcagcccgccttcggtccccgccgagccagtctagtgacacag
gatgaccccaagtgtcacggcctcagcaaacaccggaatgagcccccccagtccctcacg
gggatagtaaagacagttccagaatccctgaggaagctggatatgcccccgtcggcctgc
ccacggcacgtgaggatcaaaaactggggcagtgggatgactttccaagacacacttcac
cacaaggccaaaggggatcttgcttgcaggtctaagtcttgtctgggagccatcatgaac
cccaaaagtttgaccagaggacccagggacaagcctacccccccagacgagcttctacct
caagctatcgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagaggaa
catctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcagctg
acgggagatgagctcatcttcgccaccaagcaggcttggcgcaatgccccccgctgcatc
gggaggatccagtggtccaacctacaggtcttcgacgcccggagctgttccactgcccag
gaaatgttcgagcacatctgcagacacgtgcgttatgctaccaacaatggcaacatcagg
tcggccatcaccgtgttcccccagcggagtgatgggaagcatgacttccggatctggaac
gctcagctcatccggtatgctggctaccagatgcctgatggcactatcttgggggaccct
gccagcgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggccgc
tttgatgtggtgcctctggtcctgcaggctgatggcggagaccctgagctctttgaaatc
ccgcctgacctcgtgctcgaggtgcccatggaacatcccaagtatgagtggttccgtgaa
ctggagctaaagtggtatgccctgcctgccgtggccaacatgctgctcgaggtgggtggc
ctggagttcccagggtgccccttcaacggctggtacatgggcacggagatcggggtccgg
gacttctgtgacgttcagcgctacaacatcctggaggaagtgggcagaaggatgggcctg
gaaacgcacaagctggcctcactctggaaggaccgggctgtcattgagatcaacgtcgcc
gtgctgcacagtttccagaagcaaaatgtgaccatcatggaccaccactcagctgcggag
tccttcatgaaatacatgcagaacgagtaccggtcccgagggggctgtcctgccgactgg
atttggctggtgcccccgatttctggcagcatcactcccgtgttccaccaggagatgtta
aactatgtcctgtcccctttcttctactaccaggtggaggcctggaaaacccacatctgg
caggatgagaagcggagaccccggagaagaaagattccgttcaaagtcttggttcaagct
gtgctcttcgcctccatgctgatgcgcaagaccatggcgtcccgagtgagagccacaatc
ctctttgcaacggagacaggaaagtcagaaacactggcccgggacctaggggccttgttc
agctgtgccttcaaccccaagattctctgcatggaccagtacgggctgagcaacctggag
gaagagcagctactactggtggtgaccagcacgtttgggaacggagattcccccggcaac
ggagagaaactgaaaaaatccctcttcatgctgaaagagcttaccaacaagttcaggtat
gccgtgttcggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgacatc
gaccagaagctgtcccatctgggggcctctcagcttgccccaacaggggaaggggacgag
ctcagtggacaggaggaagccttccgcagctgggccgtgcaaaccttcaaggcagcctgt
gagacgttcgatgtgcgaggcaagcaccgcattcagatccccaagctctacacctccaat
gtgacctgggacccgcaccactacaggctcgtgcgggactcacagcctctggacctcaac
aaagccctcggcagtatgcacgccaagaacgtgttcaccatgaggctcaaatcacagcgg
aatctccagagtgcgaaatccagccgcaccaccctcctggtggagctctcctgtgaggac
agccaccggctgagctacctgcctggagagcacctcggggttttcccaggcaaccagctg
gctctggtaaaaggcatcttggagcgagtggtggacggccctgcgccccaccaaccggtg
cacctggagaccctcagcgagagcggaagctactgggtcagagacaagcggctgcccccg
tgctcgctcagccaggccctcacctacttcctggatatcaccacccccccaacccagctg
ctgctccgcaaattggcacagctggccacagaagaggcagagaggcagaggctggagatc
ctgtgccagccctcagagtacaacaaatggaagttcaccaatagccccacattcctggag
gtactggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctgcct
attctgaaaccccggtactactccatcagctcctccagggcctgtgcacccacggaggtc
cacctcactgtggctgtgctcacctaccgcacccgagatggccaaggtcccttgcaccac
ggcgtctgcagcacgtggctcagcagcctgaagccccaagacccagtaccctgctttgtg
agaagtgccggcggcttccagctccctgaggacccctcccgaccttgcatcctcattggg
cccggcacaggcatcgcccccttccgcagcttctggcagcagcggctccatgatgccgag
cacaaagggctccggggcagccgcatgaccctggtgttcgggtgccgccgcccggatgag
gaccacctctatcgggaggagatgttggagatggcccagaagggggtgctgcatgaggtt
cacacagcctactctcgcctgcctggccagcccaaggtctatgttcaagacatcctgagg
cagcagctggccagcgaggtgctccgcgtgctccataaggagcaaggccacctttatgtc
tgtggggatgtgcgtatggcccgggatgtggcccaaaccctgaagcacctgctggccgcc
acgctgagcctgagtgaggagcaggtggaggactatttcttccaacttaagagccagaag
cgctatcatgaagacatctttggtgctgtatttccctacgaggtgaaaaaggatggggca
gcaaggcagcccagcgatcccagagttccagcggcccacgggacaagttaa

DBGET integrated database retrieval system