KEGG   Felis catus (domestic cat): 101087284
Entry
101087284         CDS       T02385                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101087284
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101087284
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101087284
Pattern recognition receptors [BR:fca04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   101087284
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 PIN_12 SprT-like AAA_25 AAA_16
Other DBs
NCBI-GeneID: 101087284
NCBI-ProteinID: XP_011287849
Ensembl: ENSFCAG00000022541
UniProt: A0A337S3N5
LinkDB
Position
E2
AA seq 985 aa
MASSFFSDFGLMWYLEELKKDEFRKFKELLKQESLKLGLKIIPWTEVKKATREDLANLLM
RHYKEQQAWNVTFSVFNKINRKDLCEKAKKEITGHTKLYQMHVKEKFNNMWLRESIPRIQ
DHLHPELTQRERECLELFFAPKETGKQTRTVLLKGIQGIGKTTFLIRLMLAWVEGNLYQE
RFSYVFYLCCREMKQLTETSLAALLSRGWSDSSTPFVEILSQPERLLFLIDSFEELKCSL
SEPESDLCSDCMEQVPVQVLLSSLLRKKLLPESSLLITATPVYPQEVEDRLECPEIRTLL
GFSDSDKKIYFCSMFQDRNRAMEAFSFMRENEHLFIMCQIPILCWIVSTCLKQDMEKGKD
LALTCRRTTSLYSSFIFNLFTPKGASCPDEQSQGQLKGLCSLAAEGMWTNMFLFSEGDLR
RNGLVDSDISTLLDIKALQKCKEEENSYMFLHVSVQEFCAAMFYFLKSHMDHPNPAIGCR
KAVLFTYLKKEKVHWISLGCFIFGLLNEKEQQKLDTVFGFHLSQEIQQECHQYLQRIGEN
EHLQKQTDFLALCYCLFEMQNEGFVQWAMDFFQDVHFTITDHVDLRVSAYCLKYCSSLQK
LCFSIQNVFQVGNADSSVSSYNILCWHDICSVLTTNEHLRELQMSHSILSESTYVTLCNQ
LRHPSCHLQKLQMNNVTFAGDSWLFFEVLTHSPDLKYLNLNGTTLSRNDVKLLCNALNNP
MCNVEELLLANCHLSANDCEDFTCVLNSSKKLKLLNVSYNYLDQGVPLLCEALQRPDCGL
EGLILGYCYLTEHSWKYLYNVLLYNKSLTHLDLSANVLKYENLKLLCEALKQPGCHLWSL
CLVKCSITADGCRDLASVLTGNQNLRSLQISYNDIEDAGVKLLCQGLAHPSCHLEILGLA
TCKLTSACCEDLSSALTSSKTLQSLNLQGNALDHTGVAVLCEALRHPACTLQILGLQKTE
FDEETQRLLTVAEEENPSLTVIGDW
NT seq 2958 nt   +upstreamnt  +downstreamnt
atggcatcatctttcttttctgattttggcctgatgtggtacctggaggagctcaaaaag
gatgagttcagaaaatttaaggagctcttaaaacaggagtctctgaagcttggactcaag
ataattccctggactgaagtaaagaaggcaacacgggaagatcttgcaaacctgctgatg
aggcattacaaggaacagcaagcatggaatgtgactttcagcgtctttaacaagatcaat
agaaaagatctctgtgagaaggcaaagaaagagatcacaggacacacaaagttgtaccaa
atgcacgtgaaggagaaattcaacaacatgtggctcagagaatctatccccaggattcaa
gatcacttacatcctgaactcacccagagagaacgtgaatgcttggaactgttttttgct
cctaaggaaactgggaaacagacacggacggtgctcctcaaaggaatacaagggattggg
aagacaacattcctgatcaggctgatgttggcctgggtggagggcaacctctaccaggag
agattctcctatgttttctacctctgctgccgggagatgaagcagttgacagagaccagt
ttggctgcactcctctctagaggctggtctgactcctccactccttttgtggagatcctg
tcccaaccagagagactcttgtttctcatagacagcttcgaagaactgaaatgtagcctg
agtgaacctgagtcagatctgtgcagcgactgtatggagcaggtgccagtacaggtgctc
ctgagcagcttgctgaggaagaaattgctccccgagtcctcgctgctcatcactgctaca
cctgtgtacccccaggaagttgaggataggttggagtgcccagaaattagaacactcctg
ggattcagtgacagtgataagaagatctatttctgctctatgtttcaagaccggaataga
gccatggaagccttcagtttcatgagagaaaatgagcatttgtttatcatgtgccaaatc
cccatcctttgctggattgtgagcacttgtctgaagcaggacatggaaaaggggaaagac
ctggcgctgacctgccgacgtaccacctctctttatagctctttcatctttaacttgttc
acgcccaagggggctagctgtccagatgagcaaagccaaggccagttgaagggcttgtgt
tccctggctgcagagggtatgtggaccaacatgtttttgttcagtgaaggggacctcagg
agaaatgggttagttgattctgacatctctacgttgctggacataaaggctcttcagaag
tgcaaggaggaggagaattcctacatgtttctccatgtgagcgtccaggagttctgtgcc
gccatgttctattttctcaagagccacatggaccatcctaacccagctattggatgtaga
aaggctgtgctatttacctatttgaagaaagaaaaggtacattggatttctttggggtgt
ttcatattcggccttttaaatgaaaaggaacaacaaaagctggatacagtttttggcttt
cacctgtcccaggagatacagcaggaatgtcaccagtacttgcagcgcataggtgagaat
gagcatcttcagaaacagacagatttcttggcattgtgttactgtctgtttgagatgcag
aatgaaggttttgtgcagtgggcaatggacttcttccaagatgttcactttaccatcacg
gaccacgtggacttgcgggtttctgcctactgcttaaaatactgttccagtttgcagaag
ctttgcttctccatccagaatgtctttcaagtgggaaatgcagacagctctgtgtcaagt
tacaatatcctctgttggcatgatatctgctctgtgctcactacaaatgagcacctcaga
gaactccaaatgagtcacagtatcctcagtgagtcaacctatgtaactttgtgtaatcag
ctgaggcatcccagctgtcacctccaaaagcttcagatgaataatgttaccttcgctggt
gacagttggcttttctttgaggtgctcactcatagtccagatttgaaatacctgaacctc
aatggtacaacactctcgcgcaatgatgtgaagttgctctgtaatgccctgaacaatcca
atgtgcaatgtagaagaactactgctggcaaattgtcacctttcagcaaatgattgtgaa
gactttacctgcgtcctaaacagcagcaagaagctgaagcttcttaatgtatcctacaac
tacctggaccaaggggtacccctgctgtgtgaggccttgcagcgccctgactgtggtcta
gagggcttgatattaggttactgttacctcactgaacactcctggaaatacctctacaac
gttcttctgtataacaaaagcttgacccatctagacctcagcgccaacgtcctgaaatat
gaaaacttgaaacttctctgtgaggccttgaagcagccaggctgccacctgtggtcactg
tgtttggtgaaatgttccatcaccgctgatggctgtcgagacctcgcctcagtcctcact
ggcaatcagaacttgagaagtctacaaatcagctacaatgacatagaagatgctggtgtg
aagctgctgtgtcaaggtctagcacatcccagctgtcacttagagattcttgggctggct
acatgcaagttaacaagtgcctgctgtgaggacctctctagtgccctcaccagcagtaaa
accctgcagagtctgaacctgcaaggaaacgccctggaccacactggagtggcggtgcta
tgtgaagccctgagacacccagcgtgcaccctgcagattctagggctgcaaaaaactgaa
tttgatgaggaaacccagagacttctgacagttgcagaagaagaaaatccctccttgaca
gttataggtgactggtga

DBGET integrated database retrieval system