KEGG   Felis catus (domestic cat): 101088150Help
Entry
101088150         CDS       T02385                                 

Gene name
PIGT
Definition
(RefSeq) GPI transamidase component PIG-T isoform X2
  KO
K05292  GPI-anchor transamidase subunit T
Organism
fca  Felis catus (domestic cat)
Pathway
fca00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    101088150 (PIGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 101088150
NCBI-ProteinID: XP_003983478
Ensembl: ENSFCAG00000026095
UniProt: M3WVG3
LinkDB All DBs
Position
A3
AA seq 578 aa AA seqDB search
MAAALPLVLLVLLLLGPVGRGHAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EEVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANGTDHNFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSVSWELRQ
TLSVVFDAFVTGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITGYNQDNETLEVTPPP
TTTYQDVILGARKTYAVYDLLDTAVINNSRNLNLQLKWKSPPESEAPPVPFLHAQRYVSG
YGLQNGKLNTLLYNTHPHRAFPVLLLDTVPWHLRLYVHTLTITSKGKDNKPSYVHYQPAQ
DRLQPHLLEMLIQLPANSATKVSIQFERALLKWTEYTPDPNHGFYVSPSVISALVPSTVA
AKPVDWEESPLFKSLYPVSDSSSYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPSTGGLAKRLANLIRRARGVPPL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccttgccgcttgtcctgttagtgctgctgctcctgggtccggtgggcagg
ggccatgcagagcccccacgcgacagcctgagggaggagctcgttatcaccccgctgcct
tctggggacgtagccgccacgttccagttccgcacgcgctgggattcggagctgcagcgg
gaagaagtatctcattataggctatttcccaaggccctggggcagttgatctccaaatat
tctctacgagagctgcacttgtcattcacgcaaggcttttggaggactcgatactggggg
ccacctttcctgcaggccccatcaggtgcagagctctgggtctggttccaagacaccgtc
actgacgtggataaatcttggaaggagctcagtaacgtgctctcgggtatcttctgcgcc
tctctgaacttcattgactccaccaacacggtcactcccactgcttccttcaaacccctg
ggactggccaatggcactgatcacaatttcctgcgctacgctgtgctaccgcgagaggtt
gtctgcactgagaacctcaccccatggaagaagctcttgccctgcagctccaaggcaggc
ctgtctgtgctgctcaaggctgaccgcttgttccacactagctaccactcccaggcagtg
catatccgtcctgtttgcaggaatgcacgctgtaccagcgtctcctgggagctgaggcag
acgctttctgttgtgtttgatgccttcgtcacaggacaggggaagaaagattggtccctc
tttcggatgttctcccgaaccctgacggagccctgccccctggcttcagagagccgagtc
tatgtggacatcaccggctataaccaggacaatgagacgttggaggtgacccctccccca
accaccacctaccaggacgtcatcctcggcgcccggaagacctacgccgtctacgacttg
ctggacacggctgtgatcaacaactctcgtaacctcaacctccagctcaagtggaagagc
cccccagagagcgaggcccctccggtgcccttcctgcatgcccagaggtacgtgagcggc
tacgggctgcagaacgggaagctgaacacgctgctgtacaacacgcacccacaccgggcc
ttccccgtgctgctgctggacaccgtgccctggcacctgcggctgtatgtgcacaccctc
accatcacttccaagggcaaggacaacaaaccgagttacgtccactaccagcccgcgcag
gaccggctgcagccgcacctcctggagatgctgattcagctgccggccaactcggccacc
aaggtgtccattcagtttgagcgggcgctgctcaagtggaccgagtataccccggacccc
aaccacggcttctatgtcagcccgtctgtcatcagtgccctcgtgcccagcacggtggca
gccaagcccgtggactgggaagagagccccctgttcaagtccctgtacccggtctccgat
agctctagctactttgtgcgcctctacacggagccgctgctggtgaacctgcccacgccg
gacttcagcatgccctacaacgtcatctgcctcacgtgcacggtggtggccgtgtgctat
ggctccttctacaatctcctcacccgaaccttccacatcgaggagcccagcacgggcggc
ctggccaagcggctggctaaccttatccggcgtgcccgtggcgtgccgccgctctga

DBGET integrated database retrieval system