KEGG   Felis catus (domestic cat): 101088157
Entry
101088157         CDS       T02385                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca01522  Endocrine resistance
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04611  Platelet activation
fca04713  Circadian entrainment
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04727  GABAergic synapse
fca04740  Olfactory transduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04918  Thyroid hormone synthesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca04962  Vasopressin-regulated water reabsorption
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca04972  Pancreatic secretion
fca04976  Bile secretion
fca05032  Morphine addiction
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101088157 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101088157 (ADCY3)
   04371 Apelin signaling pathway
    101088157 (ADCY3)
   04020 Calcium signaling pathway
    101088157 (ADCY3)
   04072 Phospholipase D signaling pathway
    101088157 (ADCY3)
   04024 cAMP signaling pathway
    101088157 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101088157 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101088157 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101088157 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101088157 (ADCY3)
   04062 Chemokine signaling pathway
    101088157 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101088157 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101088157 (ADCY3)
   04912 GnRH signaling pathway
    101088157 (ADCY3)
   04913 Ovarian steroidogenesis
    101088157 (ADCY3)
   04915 Estrogen signaling pathway
    101088157 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101088157 (ADCY3)
   04921 Oxytocin signaling pathway
    101088157 (ADCY3)
   04926 Relaxin signaling pathway
    101088157 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    101088157 (ADCY3)
   04918 Thyroid hormone synthesis
    101088157 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101088157 (ADCY3)
   04916 Melanogenesis
    101088157 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101088157 (ADCY3)
   04927 Cortisol synthesis and secretion
    101088157 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101088157 (ADCY3)
   04270 Vascular smooth muscle contraction
    101088157 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101088157 (ADCY3)
   04971 Gastric acid secretion
    101088157 (ADCY3)
   04972 Pancreatic secretion
    101088157 (ADCY3)
   04976 Bile secretion
    101088157 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101088157 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101088157 (ADCY3)
   04727 GABAergic synapse
    101088157 (ADCY3)
   04725 Cholinergic synapse
    101088157 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101088157 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101088157 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101088157 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101088157 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101088157 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088157 (ADCY3)
   04714 Thermogenesis
    101088157 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088157 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101088157 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101088157 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101088157 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101088157 (ADCY3)
   05163 Human cytomegalovirus infection
    101088157 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101088157 (ADCY3)
Enzymes [BR:fca01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101088157 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 101088157
NCBI-ProteinID: XP_011279570
Ensembl: ENSFCAG00000003651
LinkDB
Position
A3
AA seq 1152 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVYSSDKLAPLVVAGMGLLLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLITAQIFSYLGLNFARAHAASDTVGWQTFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGRHLLREILANVCLYLCAIMVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCE
YLDEKGIETYLIIASKPEVKKTAAQHGLDGPALLNGAPASSKPSSPALIETKEPNGSIHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YMTFVVGEVLLLILTVCSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYHTGPVNSTAGTEAEDGCVENPKYYSYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWRPIFDEYDRKRFQEHDFPVVALEKMQVLSTPGLNGTDRLPLVPSK
YSMTVMIFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFANSNKEEKSDRERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVCPARAEHVLRPRDRAQSQNRGCFATCYCLLSVGPGYQVGVFGRLKARVERDASG
EGRKYFDPISKI
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgccaaggaaccagggcttttcggagcccgagtactcggctgagtactccgccgaatac
tcggtcagcctgccctctgaccccgaccgcggggtgggccggacccatgaaatctctgtc
cggaactcgggatcctgcctctgcctgcctcgattcatgaggctgaccttcgtgcccgag
tccttggagaacttgtaccagacctacttcaaacggcagcgccatgagacgctgctggtg
ctggtggtctttgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtctac
tccagcgacaagctggctcccctggtcgtcgctgggatgggactgctgttggacatcctc
ctcttcgtgctctgcaaaaaggggcttctccccgaccgtgtcacccggaaagtggtgccc
tacctgctgtggctgctgataactgcccagattttctcctacctgggcctgaactttgcc
cgcgcgcatgcggccagcgacacggtgggctggcagaccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctccgtggtctcctgtgttgtg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggatggcctgaaaggcagg
cacttgctgagggagatcctggccaacgtctgcctctacctgtgtgccatcatggtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaaaatgaacctcgaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcatgtggctgacgagatgctaaaggacatgaagaaggacgagagc
caaaaggaccagcagcagttcaacaccatgtacatgtatcgccacgagaatgtcagcatc
ctcttcgcggacatcgtgggcttcacccagctgtcttccgcctgcagtgcccaggagctc
gtgaagctgctcaacgagctcttcgcccgctttgacaagctggcggccaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtctgctccatccttatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacaggcacggtg
ctggggggcgtcctgggccagaagcgctggcagtatgacgtgtggtccactgacgtcact
gtggccaacaagatggaggccggtggcatccccgggcgtgtgcacatctcccagagcacc
atggactgcctaaagggcgagttcgacgtggagccgggcgacgggggcagccgctgcgag
tacttggacgagaagggcatcgagacctacctcatcatcgcgtccaagccagaggtgaag
aaaacagccgcccagcacggcctcgacggcccggccctgctgaatggagcgccagcttcc
tcaaagcccagctctcccgccctcattgagaccaaggagcccaacggaagcatccacacc
agcggctccacgtcagaggagcccgaggagcaggatgcccaggcggacaatccctcgttc
cccaacccgcgccggaggctgcgccttcaggacctggctgatcgagtggtggacgcctct
gaggacgagcatgagctcaaccagctactcaatgaggccctgcttgagcgagagtccgcc
caggtagtgaagaagagaaacaccttcctcctttccatgcggttcatggaccccgagatg
gaaacccgctactccgtggagaaggaaaagcagagtggggccgcctttagctgctcctgt
gttgtcctgctctgtacggccctggtcgagatactcatcgacccctggctgatgacaaat
tacatgacctttgtggtcggggaggttctccttctgatcctgacggtctgctcgctggcc
gccatctttccccgggcctttcctaagaagctcgtggccttctcgacttggatcgaccgg
acccgctgggccagaaacacctgggccatgttagccatcttcattctggttatggcaaac
gttgtggacatgcttagctgcctgcagtaccacacaggccccgtcaacagcaccgcaggg
acggaggcagaggatggctgcgtagagaaccccaagtattacagctatgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgcttgtcacgggtgctgtggccgtcatcaacatctacgcctggcgccccatctttgat
gaatatgaccgcaaacgtttccaggaacatgactttcctgtggtcgccttagagaagatg
caggtactttccacccccgggctcaacggcactgacaggctgcccctggtgccttctaag
tactccatgacagtgatgatcttcatcatgatgctgagcttttactacttctcgcgccac
gtggaaaaattggcacggacactgttcttgtggaagattgaggtccatgaccagaaggaa
cgcgtctacgagatgcggcgctggaatgaggccttggtcaccaacatgttgcctgagcac
gtggcacgccatttcctggggtccaagaaaagagatgaggagctgtacagccagtcttac
gatgagatcggagtcatgtttgcctccctgcccaacttcgccgacttctacacagaggag
agcatcaataatggtggcatcgagtgtctgcgcttcctcaacgagatcatctcagatttt
gattctctcctggacaatcctaagttccgggtcatcaccaagatcaaaaccatcggcagc
acctatatggcagcttcaggagtcaccccggatgtcaacaccaatggcttcgccaactcc
aacaaggaggaaaagtctgaccgggagcgctggcagcacctggctgacctggctgacttc
gctctggccatgaaggacacactcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaacca
cattatgacatctggggcaatacggtcaatgtagccagcaggatggagtccacaggggtc
atgggtaacattcaggtatgtccagcgagagccgagcatgtgctcagacccagggaccgg
gcacaaagtcagaatagggggtgcttcgccacatgctactgcctcctttctgttggccca
ggttatcaagttggtgtttttggaagattaaaggcaagggtggaaagggatgcctcagga
gaagggaggaaatacttcgaccccatttccaaaatttag

DBGET integrated database retrieval system