KEGG   Felis catus (domestic cat): 101089953Help
Entry
101089953         CDS       T02385                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101089953 (GPD2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     101089953 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 FAD_oxidored GIDA EF-hand_8 EF-hand_5 Pyr_redox_2 EF-hand_9 NAD_binding_8 HI0933_like Thi4 EF-hand_10 Pyr_redox Pyr_redox_3 RNA_pol_Rpb4 FAD_binding_3 Dockerin_1 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 101089953
NCBI-ProteinID: XP_003990833
Ensembl: ENSFCAG00000011697
UniProt: A0A2I2U7M0
LinkDB All DBs
Position
C1
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALASVLGLSQFAHYRRKQVNLAYVQAAECVSEPVNREPPSREAQ
LLSLQNTAEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPHTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDTVRKM
DDKNAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
ITHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAIKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggactattcttgttggaggaggtgctcttgcaagt
gttctaggcctctctcagtttgctcattacagaaggaaacaagtgaacctggcctatgtg
caagcagcagagtgcgtttcagaacctgttaacagggagcctccctcccgagaagctcag
ctactgagtttgcagaacacggcggaatttgatatcctcgtcatcggaggtggagcaacg
ggatgtggctgtgccctggatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggctatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcacgagcgtgccaacctactagaaattgctccccatttatcagctccgttgcctata
atgcttcctgtttacaagtggtggcagctaccttattactgggtaggaatcaagctatat
gatctggttgcaggaagcaattgcctgaaaagcagttatgtcctcagcaaatcgagagcc
cttgaacatttcccaatgctccagaaggacaaactggtaggagcaatcgtctattatgac
ggacaacacaacgatgcacggatgaaccttgccattgccctcactgctgccaggtacggg
gctgccacagccaattacatggaggtcgtgagcttgctcaagaagacagacccccacacg
gggaaagagcgagtgagcggtgcacggtgtaaggacgtgctcacagggcaggaatttgat
gtgagagccaaatgcgttatcaatgctacgggacctttcacagacaccgtgcgcaaaatg
gatgataagaacgccgcagctatctgccagccgagcgctggtgtccacattgtgatgcct
ggttattacagcccagagagcatgggactgcttgacccagcaaccagcgatgggcgagta
attttcttcttaccctggcaaaagatgacaatagcaggcactaccgacactccaacggat
attacacaccatcccatcccttcggaagaagatatcaatttcattttgaacgaagtgcgt
aactacctgagttgtgatgttgaagtgagaagaggggatgtcctggcagcatggagtggt
atccgtccccttgtcacagatcccaagtctgcagacactcagtccatctccagaaatcat
gttgtggatatcagtgagagcggcctgatcactatagcaggtgggaagtggacaacgtat
cgctctatggcagaagataccataaatgctgctatcaagactcacaatctgaaagcaggg
ccaagcagaacggttgggcttttccttcaaggaggcaaagattggagccccacactctat
attcggcttgtccaggattacggccttgaaagtgaggttgcacagcatctggccgccacc
tatggggacaaggcttttgaggtggccaaaatggcaagtgtaaccggaaaaaggtggcct
atagtgggagtgcgtcttgtgtcagaatttccatacattgaagcagaggtgaaatacggg
attaaggagtatgcctgcacggcagtggatatgatttcacggcgtactcgcctggctttc
ctaaatgtccaggccgcagaggaagcccttcccaggattgttgaactgatgggcagagaa
ctcaattgggatgattataaaaaagaggaggaacttgaaacagccaggaagtttctgtat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagccta
ctgccttcagacatcgacaggtacaagaagagatttcataagtttgatgcagaccaaaag
ggctttattactattgttgatgttcagcgtgtgttagagagtatcaatgtccaaatggat
gaaaatacactacatgaaattctgaatgaagtagatttaaacaaaaatggacaggttgaa
ctcaatgagtttttgcagctgatgagtgctattcagaaaggaagggtgtctggaagccgg
cttgctatactcatgaaaactgcagaagagaacctcgatagaagagtccccattccagtg
gaccgaagttgtggaggattgtga

DBGET integrated database retrieval system