KEGG   Felis catus (domestic cat): 101090765
Entry
101090765         CDS       T02385                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04540  Gap junction
fca04630  JAK-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101090765 (PDGFRA)
   04014 Ras signaling pathway
    101090765 (PDGFRA)
   04015 Rap1 signaling pathway
    101090765 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101090765 (PDGFRA)
   04020 Calcium signaling pathway
    101090765 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101090765 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101090765 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101090765 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101090765 (PDGFRA)
   04540 Gap junction
    101090765 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101090765 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101090765 (PDGFRA)
   05206 MicroRNAs in cancer
    101090765 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101090765 (PDGFRA)
   05231 Choline metabolism in cancer
    101090765 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101090765 (PDGFRA)
   05218 Melanoma
    101090765 (PDGFRA)
   05215 Prostate cancer
    101090765 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101090765 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101090765 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101090765 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101090765 (PDGFRA)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101090765 (PDGFRA)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101090765 (PDGFRA)
CD molecules [BR:fca04090]
 Proteins
  101090765 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 101090765
NCBI-ProteinID: XP_003985426
Ensembl: ENSFCAG00000009141
UniProt: M3WAV8
LinkDB
Position
B1
AA seq 1089 aa
MGTSHLALLVLVCLLTGPSLISCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEVRNEENNSGLFVTVLEVVNASAAHTGLYTCYYNHTQTDENEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPKTPVTLRSSDGVVHASYDSRQGFNG
TFSVGPYICEATVSGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEVRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTVLANNISNIITEVHRRD
RSTVEGRVTFTRVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSTSDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKNGYRMAKPDHATSEVYEIMVKCWHSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKHEEDKLKDWEGSLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFVKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccacctggcgctcctggtgttagtctgtctcctcacaggaccgagccta
atctcctgccagctttcattaccctctatccttccaaacgaaaatgaaaaggtcgtgcag
ctgaattcctccttttctctgcgatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaagtcagaaatgaagaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcaatgcgtcggcggcccacacgggactgtacacttgc
tattacaaccacactcagacggacgaaaacgagatcgaaggcaggcgcatttacatctat
gtcccagacccagacgtagccttcgtacctctaggaatgacagattatttagttatcgtg
gaggacgatgactctgccatcataccttgtcgcacaactgatcccaagactccggttacc
ttacgcagcagtgacggggtggtacacgcctcctatgacagcagacagggctttaatggg
accttcagcgtcgggccctatatctgcgaagccacagtcagcgggaagaagttccagacc
atcccatttaatgtttacgctttaaaagcaacatcagaacttgatcttgaaatggaagct
ctcaaaactgtctataagtcaggggagacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacgatg
ctggaggagatcaaggtcccgtccatcaaactggtttacactctgacggtccccgaggcc
acggtgaaggatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gagatgaagaaagtcaccatttccgtccatgagaaagggttcattgaaatcaaacccaac
ttcagcccgttggaggctgtcgacctgcatgaagtcaaacatttcgtggtggacgtgcag
gcctacccgcctcccaggatatcctggctgaaggacaacctgactctgattgaaaatctc
acggagatcaccaccgacatagaaaagatccaggaagtaaggtatcgaagcaaattaaag
ctgatccgtgcgaaggaagaagacagtggccattacactattgtcgtccaaaatgaagac
gacgtgaagagctatactttcgaactcttaacgcaagttccttcgtctattctggacttg
gtcgacgaccaccatggctccaccgggggacagactgtgagatgcacagcagaagggaca
cctcttcccgatatcgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacggttttggcgaacaacatctcgaacatcatcacggaggtccaccgccgggac
aggagtactgtggagggccgagtgacgttcaccagagtggaggagaccatcgccgttcga
tgcctggccaagaatcttcttggagccgagaaccgagagctgaagctggtagctcccacg
ctgcgttctgaactcacagtggcggctgcagtcctggtcctgctggtgattgtgatcatc
tccctcattgtcctggtcgtcatttggaaacagaaaccgaggtatgaaattcgttggagg
gtcattgaatcgatcagccccgatggacatgaatatatttacgtggacccgatgcagctg
ccttatgactctagatgggagtttccaagagatggactagtgcttggtcgtatcctggga
tctggtgcgttcgggaaagtggtcgaaggaactgcctatggattgagccggtcccagcct
gtcatgaaagtagcagtaaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccccatttaaacattgtgaacttg
ctgggggcctgcaccaagtcaggccctatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgacacccagagaag
ccaaagaaagagttggacatttttgggctgaaccctgctgatgaaagcacacggagttac
gttattttatcttttgaaaacaatggtgactatatggacatgaagcaagcggataccaca
cagtacgtccccatgctggaaaggaaagaggtttctaaatactcggacatccagagatcg
ctgtatgatcgcccggcctcgtataagaagaaatctacgtcagactcggaagtcaaaaac
ctcctctcggacgataactcagaaggcctgactctgctggatttgttgagctttacctat
caagtggcgcgagggatggaatttttggcttccaaaaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcgcaagggaaaatcgtgaagatctgtgacttcggcctggcc
agggacatcatgcacgattcaaactacgtgtccaaaggcagcacctttctccccgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttcccttgggggcaccccgtaccctggcatgatg
gtggattccactttctacaacaagatcaagaacgggtaccggatggccaagcctgaccac
gccaccagcgaagtctatgaaatcatggtcaagtgctggcacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgttgccgggacaatataagaag
agctacgaaaagattcacctggacttcttgaagagcgaccaccctgccgtggcgcgcatg
cgcgtggactcggacaacgcctacatcggcgtcacctacaaacacgaggaagacaagctg
aaggactgggaaggcagcctggacgagcagaggctgagtgcagacagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctcagaagagagcgccattgagacaggttccagcagctctaccttcgtc
aagagagaggatgaaaccatcgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system