KEGG   Felis catus (domestic cat): 101091046Help
Entry
101091046         CDS       T02385                                 

Definition
(RefSeq) F-actin-monooxygenase MICAL2 isoform X1
  KO
K19947  F-actin monooxygenase [EC:1.14.13.225]
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101091046
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.225  F-actin monooxygenase
     101091046
Membrane trafficking [BR:fca04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101091046
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    101091046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3585 CH CAMSAP_CH LIM FAD_binding_3 Pyr_redox_2 Pyr_redox_3 FAD_binding_2 NAD_binding_7 DAO Pyr_redox NAD_binding_8 FAD_oxidored HI0933_like zf-RRN7 Lycopene_cycl Thi4 DUF5351 GCS
Motif
Other DBs
NCBI-GeneID: 101091046
NCBI-ProteinID: XP_023095331
Ensembl: ENSFCAG00000024810
LinkDB All DBs
Position
D1
AA seq 1963 aa AA seqDB search
MGENEDEKQTQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHALSDFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDYAMNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLYITKELDQWPLERLGSVRRSVGLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWGKNYGENADLSLAKSFISHNYLNLTFPR
KRTPRVDVQTEESDMNKRRRRGFNNLDEPSTFSSRSLRSSQECGSNKEGGNQNKVKSMAS
QLLAKFEENSRNPSLVKQECRISGIGKPVLRSSSDPPVNSRCPRPEEPTPGPSPPLKRQF
PSVVVTGHVLRELKQVSADCECPSRPWRARAKSDLQLGGPGSSPALPPACQGALALSGVL
RRLQQVEDRILQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNKLLSKDLSPEHTP
ASPSCLPSPDPAATSSPSTVDSVSPARKAKKSPSGFHFHPSHLRTVRPQLTVGKVSSGIG
AAAEVLINLYMNDHRPKTQATSPDLESMRKVFPLNLGGSDTCHFCKKRVYVMERLSAEGH
FFHRECFRCSVCASTLRLAAYAFDSDEGKFFCKSHFIHCKANSQQRKRRAELKQQREEEG
TWREQEAPRRDTPVESSCAAAAIGTPEGSPPADEPTSPKKPKSVLEPEPSDVEGGAISLL
PSEWTSVRISPGEDVVGQDMMAVCVLVNSDDSSSEAEPDCSGSEASSAEPREERPRRPEP
PPLPQPLTRHSSLREAPTREVSPHCPEEPQAVQALLRANSFQSVTPNKYQSCRRKFQSSS
TPVNNRRTMSPSEEAAPLSSSSLFSPSPSPPSLSSGGVPGNVLDGFSPPQVIDCNPPSQV
SRGHFSPSTPIFLRRARAQAAPKDMHLYLPHDQVLERAEYCTVRPQTPSPAETASDGCQE
TESLLGDARSIHGGPHPAGGKDRCLPDQELSLGAGEDPGERKTESGRREEGGSQPTEGKR
LGLKKLVLTPEQKTKLLDWNDSLPESVSLEAGAQPAQKSADSGRRGHVLKPVSPLLLPWT
ARETPPAQGKAQEKTGTPAERAPGEPSVPPPKSPLRLIANAIRRSLEPLLPNSTKPESKP
LPTTQPHSCTRSFSLRKTSSGKDCSQQSPGRDMARRTSAFFSWGSPPARAAQPPHPRLPD
PAFRTHSLPNRPSKVFPALVSPSCHKMEDVPTLLEKVSLQETFPDASRVPKRKISLFSSL
RLKDKSFESFFQESKQRKDLQDLFSIRRGKGEPVDSAQPLEKLAQPFTSTCLEQRVHPSP
DKDASPKHTPIRVQVTGAASSTSSTGSSSGDEEFHPQPSLQSKERETLRRRKLENAIKQM
VKQEELKRLHKAQAIQRQLEEVEERQRASEIQGVRLEKALRGEADSGTQDEAQLLQEWFK
LVLEKNKLMRYESELLIMAQELELEDHQSRLEQTLREKMLKEESQKDESDLNEEQEILSE
MMQVIEQRDRLVDSLEEQRIKEKAEDQHFESFVFSRGCQLSRT
NT seq 5892 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaaacgaggacgagaagcagacccaggccgggcaggttttcgagaactttgtc
caggcttccacgtgcaaaggcaccctccaggccttcaacatcctcacgcgacacctggac
ctagaccctctggaccacagaaacttttattccaagctcaagtccaaagtgaccacctgg
aaggccaaagccctgtggtacaaattggacaagcgtggatcccacaaagagtataagcga
gggaagtcttgtatgaacaccaagtgtctcattgttgggggaggaccatgtggtttgcgc
actgccattgaacttgcctacctaggggccaaagtggttgtggtggagaagagggacacc
ttctccaggaacaatgtgctgcacctctggcctttcaccatccatgacctacggggactg
ggagccaagaaattctacgggaagttctgcgctggctccattgaccacatcagtattcgt
cagttgcagctcatcctattcaaggtggccctgatgctgggcgttgaaatccacgtgaat
gtggagtttgtgaaggttctagagcctcctgaagatcaagaaaatcaaaaaatcggctgg
cgggcagaatttctccctgcggaccacgctctgtcggactttgagtttgacgtcatcatt
ggcgctgatggccgcaggaacacgctggaagggttccgaaggaaagaattccgtgggaag
ctggctatcgcgatcaccgccaacttcataaacagaaacagcacagccgaggccaaggtg
gaagagattagcggggtggctttcatcttcaaccagaagttttttcaggaccttaaagaa
gaaacagggattgatctggagaacattgtttactacaaggactgcacccactatttcgtc
atgactgccaagaagcagagcctgctcgacaaaggtgtcatcattaacgactacatcgac
acggagatgctgctgtgtgcggagaatgtgaaccaggacaacctgctttcctatgcccga
gaggctgcagatttcgccaccaattaccagctgccatcgttagactatgccatgaaccat
tatgggcagcccgatgtggccatgttcgacttcacctccatgtacgcctccgagaacgcg
gccttggtgcgcgagcgccagtcacaccagctactcgtggccctggtgggcgacagcctg
cttgagccgttttggcccatgggcacaggctgtgcccgaggcttcctggcagcctttgac
acggcatggatggtgaaaagctgggaccagggcacccctcccctggagctgctggccgaa
agagaaagtctctatcggctgttacctcagactaccccagagaacatcaacaagaacttt
gagcagtacacgttggacccagggacacggtacccaaatctcaactctaactgtgtcagg
ccccatcaggtgaagcatttatacatcactaaggagctggaccagtggcctctcgagagg
ctgggctcagtgaggagatccgtgggcctctccaggagggagtccgacatccggcccagc
aagctcttaacctggtgtcagcagcaaaccgagggctaccagcacgtcaatgtcaccgac
ctgaccacatcctggcgcagcggcctggccctgtgtgccatcatccaccgcttccggcct
gagctgatcaactttgactctctgaatgaagacgatgccgtggagaacaaccagctggca
tttgacgtggctgagcgtgagtttggtatccccccggtgaccacaggcaaggagatggca
tcagcccaggagcccgacaagctcagcatggtcatgtacctctccaagttctacgagctc
ttccggggcaccccgctgaggcctgtggattcttggggcaaaaactatggagaaaatgct
gacctcagcttggccaaatccttcatttctcacaactatctcaacctcacgtttccgagg
aagaggaccccgcgagtggacgtccaaactgaagagagcgacatgaacaaacggaggcgg
agaggcttcaacaacctggatgagccttcgaccttttccagccggagcctgcgctccagt
caagagtgcggcagcaataaagaaggtggaaatcagaacaaagtcaagtccatggcaagt
cagctgctggccaagtttgaggagaactctcggaacccctcgctcgtgaagcaggaatgc
cgcatctcagggataggtaagcctgtcctgcgctcttcctctgacccacctgttaactct
cgctgcccccggccggaggagcccacacccggcccatcacctcctctgaaaaggcagttc
ccctcggtggttgtgacggggcacgtgctccgagagctaaagcaagtgtctgctgattgc
gagtgcccgagcagaccctggagagccagagccaagtctgacctgcagctgggtgggcca
ggaagctctcctgctctgccccctgcctgccagggagcgctggccctttctggggtgctg
cggcggctgcagcaagtggaggacaggattctccagaagagggctcagaacttggccaac
agggaatttcacaaaaagaacattaaggagaaggcggctcacctcgcctccatgtttgga
catggggatttcccacagaataaactactttctaaggatctgtctcccgagcacactcca
gcttctccctcctgccttccatctcctgatcctgctgctacttcttctccatcgactgtt
gactctgtttctcctgccagaaaggcaaagaagtcaccttcaggtttccacttccatccc
agccacttaagaacagtgcggcctcagctgacggtagggaaagtgtccagtggaataggg
gccgcggctgaagtcctgatcaatctgtacatgaatgatcacagacctaagacccaagcc
acctctccagacctggagtctatgcggaaggtgtttcccctgaacctgggcggcagcgac
acctgccacttctgtaagaagcgcgtgtatgtgatggagaggctgagcgcagagggccac
ttcttccaccgcgagtgtttccgctgcagtgtctgtgcctccaccttgcgcctggccgcc
tacgccttcgacagcgacgaaggcaagtttttctgcaagtctcatttcattcactgtaaa
gccaacagtcagcagaggaagagacgggcagagttgaagcaacaaagagaggaggaggga
acgtggagagagcaagaggccccccggcgggacactcctgtggaaagttcttgcgcggcc
gccgccattggcacgcctgaaggcagccctccagcagatgagccaacctcccccaagaag
cccaagagtgttctggagccagagcccagtgatgtggaaggtggagccatctctctcctg
ccttctgagtggacctcagtgaggatcagccctggggaggacgtagttggacaagacatg
atggctgtgtgtgtgctggtcaacagtgatgacagcagctctgaggcagagccagactgc
agtggcagcgaggcctccagtgcagagccccgtgaggaaaggccccggcggccagagccc
ccacccctaccgcagcccctcaccaggcacagctccctgagggaggccccgaccagagaa
gtctctccacactgccctgaggagccccaagctgtgcaagctctgctccgggccaatagc
ttccagtctgtaactcccaacaaataccagagctgcagaagaaaattccagtccagttcg
acaccagtgaacaacagaagaaccatgtcaccttcagaggaagctgcccctctttcttct
tcctcattgttttctccttcaccttctcctccatctttgtcttcaggcggtgtcccaggg
aatgtcctggatggcttctccccacctcaggtgatagattgcaacccgccctcgcaggtc
tcaagaggtcacttcagcccttctaccccaatctttctgaggcgcgccagagcccaggca
gcacccaaggacatgcacctgtatctgcctcatgaccaagtgctggagcgggcagagtac
tgcacggtgaggccccagacacccagtcctgcagagacggcttctgatgggtgtcaggaa
acagagtcccttcttggggatgccagaagcatccacggaggcccacaccccgctggaggg
aaggacaggtgcttgccagaccaagagctatccctcggggctggagaagacccaggagaa
aggaaaacagaatccggaaggagagaggagggtgggtcacagccgacagaggggaagagg
ctgggcttgaagaagttagtcctcaccccggagcagaagacaaagctgctggactggaat
gactccctccctgagagtgtgagcctggaagctggggcacaacctgcccagaaaagtgct
gacagtggtcgacgaggccatgtgctgaaaccagtcagccccttgctgctcccctggaca
gcgcgagagaccccaccagcccagggaaaggctcaggagaagacggggacccccgctgaa
cgggctccaggggagccaagtgtccctccacccaagtccccacttcggctcatagcaaat
gccatccgaaggtccctggagcccctcctccccaactccaccaagccagaatcaaagccc
ttgcccaccacccagccacactcctgcactcgctcattcagccttcgaaaaaccagctcc
ggtaaagactgcagccagcagtccccagggagagacatggcacgcaggacctcagccttc
ttctcctggggctccccacccgccagggctgcccagcctccgcaccctcgccttcctgac
cctgccttccgtacccacagtttgcccaaccggccatccaaggtgtttcctgcattagtg
tccccatcctgccacaagatggaagatgtccccacactccttgagaaagtgagtttgcag
gagaccttcccagatgcttccagggttccaaagaggaagatctcactcttctcctcactc
agactcaaagacaaatcttttgagagtttcttccaagaatccaaacaaagaaaggacctc
caggacctctttagcatccgcaggggcaaaggggagcccgtggacagtgcccagcccctg
gagaagctggcacagcctttcactagcacctgcctggagcagagggtccatccttctcca
gacaaagatgcaagtcccaaacacacccctatccgagtgcaggtgacaggggccgcctct
tctacctcttccaccggctcctcctctggagacgaagagtttcatccccagccttcgctg
cagtcaaaggagagggagacacttagaagaaggaagctggagaacgcaataaaacaaatg
gttaagcaagaagaattgaaaagacttcataaagctcaggccatccagaggcagctggag
gaggtggaggagcggcagagggcttctgagatccaaggcgtgaggctggagaaggcgctg
aggggggaagcagattcaggcacacaagatgaagcacagcttttgcaggaatggtttaag
ctggttctggagaagaataaattaatgcgatatgagtcggagctactgatcatggcccaa
gaattagaactggaagatcatcaaagcagactggaacagacactaagagaaaaaatgctc
aaggaggagagccagaaagatgagagcgatctgaacgaggagcaagaaatactcagcgag
atgatgcaagtaattgaacaaagggacagactcgtggactccttagaggaacagcgcata
aaagaaaaggctgaagaccagcactttgaaagcttcgtattctccaggggctgtcagctg
agtaggacgtga

DBGET integrated database retrieval system