KEGG   Felis catus (domestic cat): 101091322Help
Entry
101091322         CDS       T02385                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101091322 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101091322 (KMT5C)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101091322 (KMT5C)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101091322 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101091322
NCBI-ProteinID: XP_023101764
LinkDB All DBs
Position
E2
AA seq 503 aa AA seqDB search
MRLETETLAKSCAAHKRPFPGRRPCPCIVPPTLGQRQHGPRGTMGPDRVTARELCENDDL
ATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLKQRDLEAAYRALTLGGWMAHY
FQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLEL
LVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGN
AACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEGAFRLRPREPAPPRLLDK
YELRETKRRLQQGLEGGGRLGPRACAHLSPLLRDPFCAACQPLRPLPCGARPDASPLWLQ
WLPQPQPRVRPRRRRRPQPRRAPAPPLLRAARVSLHQWGGCGPRCCLQAEALVALGPAPR
AHWAPQQDWHWARRYGLPYVVRVDLSRVARPPPAAPAPAPAGTPGPTPIPKKALAFAPFS
PPKRLRLVVSHGSIDLDVNGDGP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagactggagaccgaaacgcttgccaaatcctgcgcagctcacaaacggcccttcccg
gggcgccgcccctgcccctgcattgtgcccccgactcttggccagaggcagcatggtccg
cggggcaccatgggacctgacagagtgacagccagagagctgtgtgagaatgacgacctt
gccaccagccttgtcctggacccctacctcggcttccgcacccataagatgaacgtcagc
cccgtgccccccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaag
cagcgggacctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactac
ttccagagccggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctc
cgagccttcctgcctgaaagcggctttaccatcctgccctgtacacgctattctatggag
acaaatggagccaagattgtgtctaccagagcttggaagaagaacgagaagctagaactg
ctggtgggctgcatcgcggagctgcgggaggctgacgaggggctgctgagggccggcgag
aacgacttcagcatcatgtactccacccgcaagcgcagcgcacagctgtggctgggcccc
gccgccttcataaaccacgactgcaaacccaactgcaagtttgtgcccgcagatgggaac
gcagcctgtgtgaaggtactccgggacattgagccgggggacgaggtaacctgcttctat
ggcgaaggcttctttggtgaaaagaatgagcactgtgaatgctatacctgtgagaggaga
ggcgaaggggccttccgactgcggcccagggaacccgcgcccccgcggctgctggacaag
tacgagctccgggagaccaagcggaggctgcagcagggcctggagggtggtggccggctg
ggccccagggcctgcgcccacctgtccccactactccgggacccgttctgtgctgcctgc
cagcccctacgccccctgccctgcggcgcccgccctgacgcctcgcccctctggctccag
tggctgcctcagccccagccccgggtgcgcccccggagacgccgacgcccccagccccgg
agggccccagctcccccccttctccgtgctgcccgcgtctccttgcaccagtggggaggc
tgtggcccccgatgctgcctgcaggcggaggccctggtggccctgggcccggccccccgc
gcccactgggcccctcagcaggactggcactgggcccggcgctatgggctgccttatgtg
gtgcgcgtggacctgagccgggtggcccggcccccacctgccgcccccgcccctgcccct
gccgggaccccaggccccacccccatccccaagaaggccctcgcctttgcccccttctcc
ccacccaagcgcctgcggctggtggtcagccatggctccattgacctggatgtcaacggt
gacgggccgtga

DBGET integrated database retrieval system