KEGG   Felis catus (domestic cat): 101091350Help
Entry
101091350         CDS       T02385                                 

Gene name
COLGALT1
Definition
(RefSeq) procollagen galactosyltransferase 1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00310  Lysine degradation
fca00514  Other types of O-glycan biosynthesis
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101091350 (COLGALT1)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101091350 (COLGALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fca01003]
    101091350 (COLGALT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     101091350 (COLGALT1)
Glycosyltransferases [BR:fca01003]
 O-Glycan biosynthesis
  O-linked Gal type
   101091350 (COLGALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 101091350
NCBI-ProteinID: XP_023102912
Ensembl: ENSFCAG00000007512
LinkDB All DBs
Position
A2
AA seq 623 aa AA seqDB search
MAAAPRACRRGWRPRPVLLLLLLLALPPPGGPPGAAAYFPEERWSPESPLQAPRVLVALL
ARNAAHALPATLGALERLRHPRERTALWVATDHNSDNTSAVLREWLVAVKSWYHSVEWRP
AEEPRSYPDEEGPKHWSDSRYEHVMKLRQAALKSARDMWADYILFVDADNLILNPDTLSL
LIAENKTVVAPMLDSRAAYSNFWCGMTSQGYYKRTPAYIPIRKRDRQGCFAVPMVHSTFL
IDLRKAASRNLAFYPPHPDYTWSFDDIIVFAFSCKQAEVQMYVCNKEVYGFLPVPLRAHS
SLQDEAESFMHVQLEVMVKHPPAEPSRFISVPTRTPDKMGFDEVFMINLKRRQDRRDRML
RALREQEIECRLVEAVDGKAMNTSQVEALGIQMLPGYRDPYHGRPLTKGELGCFLSHYNI
WKEVVDRGLQKSLVFEDDLRFEIFFKRRLLNLMRDVEREGLDWDLIYVGRKRMQVERPEK
AVPRVRNLVEADYSYWTLAYVISLQGARKLLAAQPLSKMLPVDEFLPVMFDKHPVSEYKA
HFSPRNLRAFSVEPLLIYPTHYTGDDGYVSDTETSVVWNNEHVKTDWDRAKSQKMREQQA
LSREAKNSDVLQSPLDSAARDEL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccccacgcgcgtgcaggcggggctggcggccgcgcccggtgctgctgctg
ctgctgctgctggcgctgccgcccccggggggcccgccgggcgccgccgcctacttcccc
gaggagcgctggagcccggagtcgccgctgcaggcgccgcgagtcctcgtcgcgctgctg
gcgcgcaacgcggcccacgcgctgcccgccacgctgggcgcgctcgagcggctgcggcac
ccgcgggagcgcacggcgctgtgggtggccacggaccacaactcagacaatacgtcggct
gtgctgcgcgaatggctggtggctgtgaagagttggtaccactctgtggagtggcggccg
gcggaggagcccaggtcctacccggacgaggagggccccaaacactggtccgactcgcgc
tacgagcacgttatgaagttgcgccaggcagccctgaaatctgcccgggacatgtgggcc
gattacatcctgtttgtggatgcagacaacctgatcctcaaccctgacacactgagcctc
ctcatcgccgagaataagaccgtggtggccccgatgctggattcgcgggctgcgtactcc
aacttctggtgtgggatgacttcccagggctactacaaacgcacacctgcctacatcccc
atccgcaagcgggaccgtcagggctgctttgcggttcccatggtgcactcgaccttcctg
atcgacctgcggaaggcggcctccaggaacttggcattctaccctcctcaccccgactac
acctggtcctttgacgacatcatcgtctttgccttctcctgcaagcaagcagaggtccag
atgtacgtctgcaacaaggaggtatatggcttcctgccagtgccgctgcgggcgcacagc
agcctccaggatgaggccgagagcttcatgcacgtgcagctggaggtcatggtgaagcac
ccaccggcggagccctccaggttcatctccgtgcccaccaggacgcctgacaagatgggc
tttgacgaggtcttcatgatcaacctgaagcgacggcaggaccggcgggaccgcatgctg
cgggcgctgcgggagcaggagatcgagtgccggctcgtggaggccgtggatggcaaagcc
atgaacaccagccaggtggaggcgctgggcatccagatgctgcccggctaccgggacccc
taccacgggcggcccctcaccaagggcgagctgggctgcttcctcagccactataacatc
tggaaggaggtggtggaccgcgggctgcagaagtcacttgtgttcgaggacgacctgcgc
tttgagatcttcttcaagagacgcctgctgaacctcatgcgggacgtggaacgggagggt
ctggactgggacctcatctacgtgggccggaagaggatgcaggtggagcggccggagaag
gctgtgccccgtgtgaggaacctggtggaggccgattactcctactggacgctggcctac
gtgatctccctgcaaggcgcccgcaagctgctggcggcccagcccctctccaagatgctg
cctgtcgacgagttcctgcccgtcatgtttgacaagcacccagtgtctgagtacaaggcc
cacttctcgccccgcaaccttcgcgccttctcggtggagcccctgctcatctaccccacg
cactacacaggggacgatggctacgtgagtgacacggagacctcggtcgtgtggaacaac
gaacacgtcaagaccgactgggaccgtgccaaatcccagaagatgcgcgagcagcaggca
ctgagtcgcgaggccaagaactcagacgtgctgcagtccccgctggacagcgccgcccga
gacgagctctga

DBGET integrated database retrieval system