KEGG   Felis catus (domestic cat): 101091725
Entry
101091725         CDS       T02385                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04060  Cytokine-cytokine receptor interaction
fca04068  FoxO signaling pathway
fca04144  Endocytosis
fca04218  Cellular senescence
fca04350  TGF-beta signaling pathway
fca04380  Osteoclast differentiation
fca04390  Hippo signaling pathway
fca04520  Adherens junction
fca04659  Th17 cell differentiation
fca04926  Relaxin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05142  Chagas disease
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101091725 (TGFBR2)
   04350 TGF-beta signaling pathway
    101091725 (TGFBR2)
   04390 Hippo signaling pathway
    101091725 (TGFBR2)
   04068 FoxO signaling pathway
    101091725 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101091725 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101091725 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    101091725 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101091725 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101091725 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101091725 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101091725 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091725 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    101091725 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101091725 (TGFBR2)
   05212 Pancreatic cancer
    101091725 (TGFBR2)
   05225 Hepatocellular carcinoma
    101091725 (TGFBR2)
   05226 Gastric cancer
    101091725 (TGFBR2)
   05220 Chronic myeloid leukemia
    101091725 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101091725 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101091725 (TGFBR2)
   05161 Hepatitis B
    101091725 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101091725 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101091725 (TGFBR2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101091725 (TGFBR2)
Protein kinases [BR:fca01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101091725 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101091725
NCBI-ProteinID: XP_023116415
Ensembl: ENSFCAG00000004384
LinkDB
Position
C2
AA seq 567 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVLKSVNNGMMVTDNNGIIKFPQLCKFCDVRSST
CDSQKSCLSNCSITSICERPHEVCLAVWRKNDENITLETLCHDPKVTYHGIALEDSASPK
CIMKEKKVLGETFFMCSCSTDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIIIFYCYRVHRQQKLSPSWDTSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRTLGSSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKEYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LQHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcacatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttctgaagtccgttaacaatggcatgatggtcaccgac
aacaatggtatcatcaagtttccgcaattgtgcaaattttgtgatgtgagatcttccacc
tgtgacagtcagaaatcctgcctgagcaactgcagcatcacgtctatctgcgagaggcca
cacgaagtctgtctggccgtctggagaaagaacgatgagaacataaccctagagacgctt
tgccatgaccccaaggttacctaccatggaattgctcttgaggactctgcttctcccaag
tgtattatgaaggaaaaaaaggtgttgggcgagactttctttatgtgttcctgtagcacc
gatgaatgcaatgactacatcatcttctcagaagaatacgccaccaacaaccctgacctg
ttgttagtcatattccaagtgacaggcgtcagcctcctgccccccctggggatcgccata
gccgtcatcatcatcttctactgctaccgtgttcaccggcagcagaagctgagcccatcc
tgggataccagcaagccacgaaagctcatggagttcagcgagcaccttgccatcattctg
gaagacgaccgctctgacatcagctctacctgcgccaacaacatcaaccacaacacagag
ctgctgcccattgagctggacaccctggtgggcaaaggccgcttcgccgaggtctacaag
gccaagctgaagcagaacacttctgaacagttcgagaccgtggcggtcaagatcttccct
tacgaggagtacgcctcctggaagacggagaaggacattttctcagacatcaacctgaag
cacgagaacatactgcagttcctgacagccgaggagcgcaagacggagctggggaagcag
tactggctgatcacggccttccacgccaagggcaacctgcaggagtacctgacgcggcac
gtcatcagctgggaggacctgcgcacgctgggcagctccctcgcccggggcatcgcccac
ctgcacagcgaccacaccctgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtcaagaacgatctgacctgctgcctgtgtgactttgggctt
tccctgcgtctggacccgaccctgtctgtggatgacctggccaacagcgggcaggtggga
actgcaagatacatggctccagaagtcctagagtccaggatgaatttggagaatgttgag
tcctttaagcagacggatgtctactccatggctctggtcctctgggaaatgacatctcgc
tgtaatgcggtaggagaggtgaaagagtacgagcctccatttggttccaaggtgcgggag
catccctgtgttgagagcatgaaggacaatgtgctgagagaccgaggacgaccagaaatt
cccagctcctggctcaaccaccagggcatccagatggtgtgcgagactctgaccgagtgc
tgggaccatgacccggaggcccggctcacggcccagtgcgtggcagagcgcttcagtgaa
ctgcagcacctggacaggctctcggggaggagctgctccgaggagaagattcccgaagat
ggctcgttgaacactaccaaatag

DBGET integrated database retrieval system