KEGG   Felis catus (domestic cat): 101092123Help
Entry
101092123         CDS       T02385                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04910  Insulin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101092123 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101092123 (GYS2)
   04152 AMPK signaling pathway
    101092123 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092123 (GYS2)
   04922 Glucagon signaling pathway
    101092123 (GYS2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    101092123 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fca01003]
    101092123 (GYS2)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101092123 (GYS2)
Glycosyltransferases [BR:fca01003]
 Polysaccharide
  Storage polysaccharide
   101092123 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 GAPES3
Motif
Other DBs
NCBI-GeneID: 101092123
NCBI-ProteinID: XP_003988535
Ensembl: ENSFCAG00000012636
UniProt: M3WHA7
LinkDB All DBs
Position
B4
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLSGLPRWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
DNYFLIGPYFEHNMKTQVERCEPINDAIRRAVDTMNKHGCQVYFGRWLIEGSPYVVLFDI
GSSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLSVKKFSAVHEFQNLHATY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLEALSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDVTVMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFQSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARYLTLSRAFPDKFHMEPTSPPTTEGFKYPRPSSVPPSPSGSQVSSPQSSDVE
DEEDERYNEEEEAERDRLNIKSPWSLGRVPRGKKKLHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatctctatctgtgacatccctgagcgggcttcctcggtgggaagtg
gaagaacttcctgtggaggatttactactgtttgaagtcgcttgggaagtaaccaataaa
gttggtggcatctatactgtaattcagacgaaggccaaaaccacagcagatgaatgggga
gacaattattttctgattggcccctattttgagcataatatgaagactcaggtggaacgg
tgtgaacctataaatgatgctatcagaagagcagtggatacaatgaataaacatggctgc
caggtgtactttggaaggtggctgatagaagggagtccttacgtggtgctatttgacata
ggctcttcggcttggaacctggacaggtggaagggagatctctgggaagcatgcagtgtc
ggcatcccttatcatgaccgagaagccaatgatatgctaatattcggatctttaaccgcc
tggttcttaaaagaggtgacggatcatgcagatgggaaacatgtcattgcccaattccat
gaatggcaggcaggaactggactgatcctttctcgagctcggaagcttcctatcgctaca
atatttaccactcatgccacactgcttggcaggtatctctgtgcagcaaacattgatttc
tacaaccatctcgataagtttgacatagacaaagaggctggggaaaggcagatttaccac
cggtattgcatggagcgagcctctgtccattgtgctcatgtgttcaccacagtatctgaa
ataacagcaatagaggcagaacatatgctgaagagaaagcctgatgtagttactccaaat
ggcttgagtgttaagaaattttcagcagtacatgagtttcaaaatctacatgccacgtac
aaggccaggatccaagattttgttcgaggtcatttctatggtcatctggactttgacctt
gaaaagactttgttccttttcattgctgggagatacgagttttcaaacaaaggagctgac
atcttcctagaagccttatccaggttaaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaaccctg
aaaggccaggcagtgcggaaacaactatgggacattgcacattctgtgaaggaaaaattt
ggaaagaaactctatgatgcattattaagaggagaaattcctgacatgaacaatattttg
gatcgagatgatgtaacagttatgaaaagagccatcttttcaactcagcgacagtctttg
cctccagtgaccactcacaacatgattgatgactccactgatcccatcctcagcaccatt
agacggatcggacttttcaacaaccgcacagacagagtcaaggtgattttgcacccagag
ttcctatcctccaccagccccttattacccatggattatgaagagtttgttcgaggttgt
catctaggagtttttccttcatactatgaaccatggggttatactccagctgaatgtacg
gtgatgggtatccccagtgtgacaaccaacctgtccggctttggctgtttcatgcaggag
cacgtggctgatcctactgcctacggcatttacattgttgacaggcggttccagtctcca
gatgattcctgcaatcagctaactcagtttctctatggattttgcaaacagtcccgccgc
cagagaattattcagagaaaccgaactgagaggctctctgatcttctggattggagatac
ttgggcagatattatcaacatgccaggtacctgacattaagcagagcttttccagataaa
ttccatatggaacctacatcaccaccaacaacagaaggatttaaatatcccaggccttcc
tcagttccaccttccccttcagggtctcaggtctctagtcctcagagcagtgatgtggaa
gatgaagaggatgagcgctacaatgaggaagaggaggctgaaagggatcggttaaatatc
aagtcgccatggtctctgggccgtgttcctcgtgggaagaaaaagctgcatggtgaatac
aagaactga

DBGET integrated database retrieval system