KEGG   Felis catus (domestic cat): 101092557Help
Entry
101092557         CDS       T02385                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00590  Arachidonic acid metabolism
fca01100  Metabolic pathways
fca04611  Platelet activation
fca04726  Serotonergic synapse
fca04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101092557 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101092557 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101092557 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    101092557 (PTGS1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101092557 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 101092557
NCBI-ProteinID: XP_006939501
Ensembl: ENSFCAG00000011194
UniProt: M3WEM6
LinkDB All DBs
Position
D4
AA seq 602 aa AA seqDB search
MSRRSRLLRFPLLLLLLLLQPPQVLPADSRAPAPVNPCCYYPCQHQGICVRFGLDRYQCD
CTRTGYSGPNCTIPELWTWLRNSLRPSPAFLHFLLTHGRWFWEFVNATFIRDMLMRLVLT
VRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPQDCPTPMGTKGKKQLPDAQILG
HRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNL
ERQYQLRLFKDGKLKYQVLHGEMYPPSVEEAPVLMHYPRNIPPQSQMAVGQEVFGLLPGL
MLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQ
LKFDPELLFGVQFQYRNRIAMEFNQLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYG
VEALVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIKESRELRLQPFNEYRKRFGLRPYTSF
QELTGEKEMAAELEELYGDIDALEFFPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNP
ICSPEYWKPSTFGGEMGFNMVKTATLKKLVCLNTKTCPYVSFHVPDPHQDDGPGVERPST
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaggagtcgtttgctccggttcccgctgctcctgctgctgctgctgctgcag
ccgccccaggtcctgcccgcggattcccgggcccccgcgccggtgaatccatgctgttac
tacccatgccaacaccaggggatctgtgtccgcttcggccttgaccgctaccagtgtgac
tgcacccgcacgggatattctggccccaactgcaccatccccgagctatggacctggctc
cggaattcactgcgacccagccccgctttcctccacttcctgctgacacatgggcgctgg
ttctgggagtttgtcaatgccactttcatccgagacatgctcatgcgcctggtactcaca
gtgcgttccaaccttatccccagccctcccacctacaacatagcgcatgactacatcagc
tgggagtccttctccaacgtgagctattatactcgtattctgccctctgtgccccaagac
tgccccacgcccatgggaaccaaagggaagaagcagttgccagatgcccagattctgggc
catcgcttcctgctcaggaggaagttcatacctgacccccaaggaaccaacctcatgttc
gccttctttgcacaacacttcacccaccagttcttcaaaacttctggcaagatgggtcct
ggcttcaccaaggccttgggacacggggtagatctcggccacatttatggggacaacctg
gaacgtcagtatcagctgcggctctttaaggatgggaaactcaaataccaggtgctgcac
ggagagatgtacccgccatcggtggaggaggcgccggtgttgatgcactacccacgaaac
attccaccccagagccagatggctgtgggtcaggaggtgtttgggctgcttcccgggctc
atgctctatgccacgctctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggct
gagcaccccacctggggtgatgagcaactcttccagacggcccgcctcatccttatcggg
gagaccatcaagattgtgattgaggagtatgtgcagcagttgagcggttacttcctgcag
ctgaagtttgacccggagctgctgttcggcgtccagttccagtaccgaaaccgcattgcc
atggagttcaaccagctgtaccactggcacccactcatgcctgactccttcaaggtgggc
tcccgggagtacagctacgagcagttcctgttcaacacctccatgctggtggactatggg
gtcgaggccctggtggacgccttctctcgccagagcgctggccggatcggtgggggtagg
aacatggaccaccatgtcttgcatgtggctgttgatgtcatcaaggaatcccgtgagctg
cggctgcagcccttcaatgaataccgcaagaggttcggcctgagaccctacacgtccttt
caggagctcacaggagagaaggagatggcagctgagttggaggagctgtatggagacatc
gatgccttggagttcttcccggggctgcttctggagaagtgccatccaaattccatcttt
ggggagagtatgatagaaattggggcccccttttctctcaagggcctcctagggaatccc
atctgttctccagagtattggaagccaagcacatttggtggtgagatgggcttcaatatg
gtcaagacagccacgctgaagaagttggtctgcctcaacaccaagacttgtccctacgtt
tccttccatgtgcccgacccccaccaggatgatgggcctggtgtggagcggccatctaca
gagctctga

DBGET integrated database retrieval system