KEGG   Felis catus (domestic cat): 101092868Help
Entry
101092868         CDS       T02385                                 

Gene name
PARK7
Definition
(RefSeq) protein/nucleic acid deglycase DJ-1
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
fca  Felis catus (domestic cat)
Pathway
fca05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    101092868 (PARK7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     101092868 (PARK7)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   101092868 (PARK7)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101092868 (PARK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3
Motif
Other DBs
NCBI-GeneID: 101092868
NCBI-ProteinID: XP_023113828
Ensembl: ENSFCAG00000022968
LinkDB All DBs
Position
C1
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVLICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQEKRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALSGKDVADQ
VKAPLVLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggccaaaggagcagaggagatggagacagtc
attcctgtagatgtcatgaggcgagccggcattaaggtcaccgttgcgggtctggccggg
aaagacccggtacagtgtagccgagatgttctcatttgtccggatgccagtctggaagat
gcaaaaaaagagggaccttacgacgtagtggttctgccgggaggtaacctgggtgcacag
aatttatctgagtctgctgctgtgaaagagatactgaaggaacaagaaaaaaggaagggc
cttattgccgctatctgtgcaggtcctacggctctcttggctcatgaaataggttttgga
agcaaagttacgacacacccgcttgctaaagacaaaatgatgaatgggagtcattacagc
tactccgagaaccgcgtggagaaggacggcctgatcctcacgagccgcgggcctggaacc
agcttcgagtttgctcttgcgattgttgaagcgctgagcgggaaggacgtggctgaccaa
gtgaaggccccgctcgtgcttaaggattag

DBGET integrated database retrieval system