KEGG   Felis catus (domestic cat): 101093124Help
Entry
101093124         CDS       T02385                                 

Gene name
AMY2B
Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101093124 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101093124 (AMY2B)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101093124 (AMY2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101093124
NCBI-ProteinID: XP_003990428
Ensembl: ENSFCAG00000027022
UniProt: M3X5H0
LinkDB All DBs
Position
C1
AA seq 511 aa AA seqDB search
MKFFLLLSVIGFCWAQYNPNTKPGRTSIVHLFEWRWADIALECERYLAPKGFGGVQISPP
NENVVINSPLRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVHIYVDAVINHMSGN
GVGAGTSSTCGSYFNPGNRDFPAVPFSHWDFNDGKCRTGSGDIENYNDPYQVRDCRLVGL
LDLALEKDYVRSKIAEYLNRLVDIGVAGFRIDASKHMWPGDMKAILDKLHNLNTNWFPEG
SKPFIYQEVIDLGGEPIKSNEYFGNGCVTEFKYGAKLGTVLRKWNGEKMAYLKNWGEGWG
FMRSDRALVFVDNHDNQRGHGAGGASILTFWDSRLYKMAVGFMLAHPYGFTRVMSSFRWP
RHFENGKDVNDWMGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQP
FRNWWDNGSNQVAFGRGNRGFIVFNNDDWPLSLTLQTGLPAGTYCDVISGDKIDGNCTGI
KIYVSGDGNAHFSVSNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgctttcagtcattgggttctgctgggctcagtataacccaaat
accaagcctggacggacatctattgtccatctgtttgagtggcgctgggctgacattgct
cttgaatgtgagcgatacttagctcctaaaggatttggaggggttcagatctctccaccc
aatgaaaatgttgtgattaatagccctttaagaccttggtgggaaagataccaaccagtt
agctacaagttatgcacaagatcaggaaatgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccatatttatgtggatgctgtaattaatcatatgagtgggaat
ggtgtgggtgcaggaacaagcagtacttgtggaagttacttcaaccctggaaatagagat
tttccagcagtcccattctctcattgggattttaatgatggtaaatgtagaactggaagt
ggagacattgagaactataatgatccttatcaggtcagagattgtcgtctggtcggtctt
cttgatcttgcactggagaaagattatgtgcgttctaagattgctgaatatctgaaccgc
ctcgttgacattggtgtagcagggttcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggataaactgcataatctgaatacaaactggttccccgaagga
agtaaacccttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcaat
gagtactttggaaatggctgtgtgacagaattcaagtatggtgcaaaattaggcacagtt
ctgcgcaagtggaatggagagaagatggcttacttaaagaactggggagaaggatggggt
ttcatgcgttctgacagagcacttgtctttgtggacaatcatgacaatcagcgaggacat
ggagctggaggagcatctattctaacattctgggactccagactgtacaaaatggcagtt
ggatttatgcttgctcatccgtatggatttacacgagtaatgtcaagcttccgttggcca
agacattttgaaaatggaaaagatgttaatgattggatggggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgattgggtctgtgaa
caccggtggcgtcaaataaggaacatggttatgttccgtaatgtagttgatggccaacct
tttagaaactggtgggataatggtagcaatcaagtagctttcggaagaggaaacagagga
tttattgtttttaacaatgatgactggccattatctttaactttgcaaactggtcttcct
gctggcacatattgtgatgttatttctggagataaaattgatggcaattgtacaggaatt
aaaatttatgtttctggggatggcaatgctcatttttctgttagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattataa

DBGET integrated database retrieval system