KEGG   Felis catus (domestic cat): 101093313Help
Entry
101093313         CDS       T02385                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03410  Base excision repair
fca03420  Nucleotide excision repair
fca03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101093313 (LIG1)
   03410 Base excision repair
    101093313 (LIG1)
   03420 Nucleotide excision repair
    101093313 (LIG1)
   03430 Mismatch repair
    101093313 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101093313 (LIG1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101093313 (LIG1)
Enzymes [BR:fca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101093313 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101093313 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101093313 (LIG1)
DNA replication proteins [BR:fca03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101093313 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101093313 (LIG1)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101093313 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101093313 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     101093313 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR
Motif
Other DBs
NCBI-GeneID: 101093313
NCBI-ProteinID: XP_023101926
Ensembl: ENSFCAG00000007411
LinkDB All DBs
Position
E2
AA seq 912 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKETSSRETEPPPKVALKERNGEVPENDSPVKRPGRKAAR
VLGSEGEEEDEALTPSKGQKPAPGSPQVSPPSPVTFPEGSPPLSNTSPAGLSPTGIPKRR
TARKQLPKRPIQDILEEQSKDEDREAKRKKEEAETPTESLTEPELAQKEEAEGDRPTTPA
EHLETSPAEPPTDSTSEPEVAGKQETREGDQAKPPPRAPKTVSSFFAPRKPATKKEGKEE
GPGAPRKEEAKGPLDPSGYNPAKNNYHPVDDACWKPGQKVPYLAVARTFEKIEEVSARLR
MVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQLE
SVKAEAAEKGDVGLVAENSRSTQRLMLPPPALTAAGVFAKFRDIAGLAGSASTAKKMDVI
KGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQDFPPAVVDAGKGR
TAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLEHLPEHCRLSPGVPLKPMLAHP
TRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISRIPK
IKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAADIQVQVCLYAFDLIYLNG
ESLVREPLSRRRQLLRENFVQTEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVKTL
DVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDEES
EELQAICKLGTGFSDEELEDHFQSLQALVLPTPRSYVRADGAVAPDHWLDPSAVWEVKCA
DLSLSPIYPAARGLVDSEKGISLRFPRFIRVREDKKPEEATTSAQVASLYKKQSQIQNQQ
GADLDSDPEDFY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtatcatgtcatttttccaccccaagaaggagggcaaagcgaaaaagccg
gagaaagagacctccagcagagagacagagccacctccaaaggtggcgctgaaggaacgg
aacggagaggtgcctgagaacgattctccagtgaagaggccagggcggaaggcggcccgg
gtcctgggcagtgaaggggaggaggaggacgaagccctcacgccctccaaaggccagaag
ccggccccaggctctccacaggtctcccctcccagccctgtcacatttcccgagggcagc
cctcccctctccaacacctctcctgcgggcctctccccaacggggatcccgaagcggcgc
acagctcggaagcagcttcctaaacggccgattcaagatatcctggaagaacagagcaag
gatgaggacagagaggcaaagaggaagaaggaagaagcagagaccccaacagaaagcctc
acagagcctgaattggcccaaaaggaggaagcagaaggggaccggcccacgacgcccgct
gagcacttagagacctccccagccgagcccccgacagacagcacctcagagcctgaggtg
gccggaaagcaggaaacacgggagggggaccaggctaagcctccccccagagctcccaag
acggtcagcagtttcttcgccccccggaagccggcgaccaagaaagaagggaaagaagag
ggacctggcgcccctagaaaggaggaggccaaaggacccctggacccctctggctacaac
ccggccaagaacaactaccatcccgtcgacgacgcctgctggaagccgggccagaaggtc
ccttacctggctgtggcccggacatttgagaagattgaggaggtttctgctcggctccgg
atggtggagacactgagcaacttgctgcgttccgtggtggccctgtcccccccagacctg
ctccccatcctctacctcagcctcaaccgcctcgggccgccccagcagggcctggagctt
ggcgtcggggacggggtcctcctcaaggcggtggcccaggccacggggcggcagctggag
tccgttaaggccgaggcggccgagaagggcgacgtggggctggtggccgagaacagccgc
agcacccagagactcatgctgcccccgcccgctctcacggccgccggggtcttcgccaag
ttccgagacatcgccgggctcgccggcagcgcttccacagccaagaagatggacgtcatc
aaaggcctctttgtcgcctgccgtcactcagaagcccgattcatcgccagagccctgagc
ggacggctacgcctcgggctggcagagcagtcggtgctggccgccctcgcccaggctgtg
agcctcacgccccccggccaagatttccccccggctgtcgtggacgctgggaagggccgg
acagcggaggcccggaagacgtggctggaggaacagggcatgatcctgaagcagacgttc
tgcgaggtgcccgacctggaccgcatcatccccgtgctgctggagcacggcctggagcac
ctcccggagcactgcaggctgagcccaggggtccccctgaaaccgatgctggcacacccc
acccgcggtgtcagcgaggtcctgaaacgctttgaggaggcggctttcacctgcgagtac
aaatacgacgggcagagggcgcagatccatgtcctggaaggcggggaggtaaagatcttc
agcaggaatcaggaagacaataccggaaagtacccggacatcatcagccgcatccccaag
attaaactgccatcagtcacatccttcatcctggacacggaagccgtggcttgggaccgg
gaaaagaagcagatccagccgttccaagtgctcaccacccgcaaacgcaaggaggtggac
gcagcagacatccaggtccaggtttgtctatatgccttcgacctcatctacctcaatgga
gagtccctggtacgcgagcccctttcccggcgccgacagctgctccgggagaacttcgtg
cagacggagggcgagttcgtcttcgccacctctctggacaccaaggacacagaccagatc
gccgagttcttggagcagtccgtgaaagactcctgcgaggggctgatggtaaagaccctg
gacgtcgacgccacctacgagatcgccaagagatcacacaactggctcaagctgaagaag
gactacctcgatggcgtgggcgacaccctggacctcgtggtgatcggcgcctacctgggc
cgtgggaagcgggccggccgctatgggggtttcctgctggcggcctacgacgaggagagc
gaggagctccaggccatatgcaagcttggaactggcttcagtgacgaggagctagaggac
catttccagagcctccaggccctggtgctgcccaccccacgctcctacgtccgggccgac
ggcgccgtggcccctgatcactggctggaccccagcgccgtgtgggaggtgaaatgtgcc
gatctgtccctgtcccccatctaccccgctgcccggggcctggtggatagcgagaagggg
atctccctccgtttcccccggtttattcgcgtccgcgaagacaagaagccggaggaggct
accaccagtgcccaggtggcctctctgtataagaagcagagtcagattcaaaaccagcag
ggcgcggacttagactccgacccggaagatttctactag

DBGET integrated database retrieval system