KEGG   Felis catus (domestic cat): 101093384Help
Entry
101093384         CDS       T02385                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04371  Apelin signaling pathway
fca05034  Alcoholism
fca05165  Human papillomavirus infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101093384 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101093384 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    101093384 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    101093384 (HDAC4)
   05165 Human papillomavirus infection
    101093384 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101093384 (HDAC4)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101093384 (HDAC4)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101093384 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101093384
NCBI-ProteinID: XP_019694538
LinkDB All DBs
Position
C1
AA seq 963 aa AA seqDB search
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDTKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPAVASIPAETSLAHRLVTREGSVAPLPLYTSPSLPNITLGLPA
TGPSAGTAGPQEADRLTLPALQQRISLFPGTHLTPYLSTAPLERDGGASHNPLLQHMVLL
EQPPTQTPLVTGLGALPLHAQALVGADRVSPSVHKLRQHRPLGRTQSAPLPQNAPALQHL
VIQQQHQQFLEKHKQQFQQQLHMSKIIPKQSEPARQPESHPEETEEELREHQALLEEPYL
DRLSGQKEAHTLAGVQVKQEPIESDDEEAEPPREVEPGQRQPTEQELLFRQQALLLEQQR
IHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVYDTL
MLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHAL
LYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVEL
VFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLDVSKTLIVDWDV
HHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPP
MGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQLM
GLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVI
EIHSQYWRSLPRLCSTVGHSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPDEEPMEEE
LPL
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccagcaggagcttctggagcaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagcttcaggagtttgtcctc
aataaaaagaaggcgctggcccaccggaacctgaaccactgcatctccagtgacccgcgc
tactggtacgggaaaacacagcacagctccctcgaccagagctccccgccccagagcggg
gtgtcagcctcctacaaccacccggtcctgggaatgtacgacaccaaagacgatttcccg
ctcagaaaaacagcctctgaacccaatttgaaattgcggtccaggctaaagcagaaggtg
gccgaaagacggagcagcccgctgctacgcagaaaagacgggcccgtggttaccgctcta
aagaagcgtccattggatgtcacagactcggcctgcagcagcgccccgggctccgcgccc
agctcgcccaacaacagctccgggaatgtcagcaccgagaacgggatcgcgcccgccgtc
gcgagcatccccgccgagaccagcttggcccacaggctcgtgactcgagaaggttccgtg
gccccgctccccctctacacgtcaccgtccttgcccaacatcacgctgggactgcccgcc
actggcccttccgctgggacggcaggtccgcaggaggccgacaggctcactctccccgcc
ctccagcagcggatctccctctttcccggcacgcacctcaccccctacctgagcacggcg
cccctggagcgggacggtggggcttcacacaacccgctgctacagcacatggtcttactg
gagcagccgcctacgcagacgcccctcgtcacaggcctgggcgcgctgcccctgcacgcg
caggcgctggtgggagcggaccgcgtgtccccgtccgtgcacaagctgcggcagcaccgc
ccgctggggcgcacgcagtcggccccgctgccccagaacgcgccggccctgcagcacctg
gtcatccagcagcagcaccagcagtttctggagaagcacaagcagcagttccagcagcag
ctgcacatgagcaagattatccccaaacagagcgagccggcccggcagcccgagagccat
cccgaggagacggaggaggagcttcgtgagcaccaggccctcctggaggagccctacctg
gaccggctctctgggcagaaggaggcacacactctggccggcgtccaagtgaagcaggag
cccatcgagagtgatgacgaggaggcggagcccccgcgggaggtagagccgggccagcgc
cagcccaccgagcaggagctgctcttcagacagcaagccctcctactggaacagcagcgt
atccaccagctgaggaactaccaggcgtccatggaggcggccggcatccccgtgtccttt
ggcggccaccggcctctgtcccgggcgcagtcgtccccggcgtctgccaccttccccatg
tccgtgcaggagccccccaccaaaccgaggttcaccacaggcctcgtgtacgacacgctg
atgctgaaacaccagtgtacctgtgggaacaccaacagccaccccgagcacgcggggcgg
atccagagcatctggtctcggctgcaggagacgggcctccggggcaaatgcgagtgcatc
cgcggacggaaggccaccctggaggagctgcagacggtgcattcggaggcgcacgccctg
ctctatggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctca
ctaacctcggtgtttgtcaggctgccctgcggtggtgtcggggtggacagcgacaccata
tggaacgaggtgcactcgtcgggcgcagcccgcctggccgtgggctgcgtggtggagctg
gtcttcaaggtggccacgggggagctgaagaacggctttgccgtggtccgccccccagga
caccacgcggaggagagcacgcccatggggttctgctactttaattccgtggccatcgca
gccaagcttctccagcaacggctggacgtgagcaagaccctcatcgtggactgggacgtg
caccacggaaatggaacccagcaggccttctacaacgatcccaacgtcctctatatctcc
cttcaccgctatgacgatgggaacttcttcccgggcagtggggcgccagacgaggtgggc
acaggcccaggtgtgggcttcaacgtcaacatggctttcactggcggcctcgatcccccc
atgggagacgcggagtatttggcggccttcagaaccgtggtcatgcccatcgccagcgag
ttcgccccggacgtggtgctcgtgtcttcaggcttcgatgccgtggagggccaccccacg
ccgctcggcggctacaacctctccgccagatgtttcgggtacctgacgaagcagctgatg
ggcttggctggcggccggattgttctggccctggaggggggccacgacctcacggccatc
tgcgacgcctcggaagcatgtgtttctgctttgctgggcaacgagcttgatcctctcccg
gaaaaggttctgcagcagagacccaatgctaacgctgtccggtccatggagaaagtcata
gaaatccacagccagtactggcgctccctgccgcgcctctgctccacggtgggacactct
ctggtagaggcccagaagtgcgagaacgaggaagccgagaccgtcaccgccatggcctcg
ctgtccgtgggcgtgaagcccgcggagaagagaccggacgaggagcccatggaagaggag
ctgcccctgtag

DBGET integrated database retrieval system