KEGG   Felis catus (domestic cat): 101093607Help
Entry
101093607         CDS       T02385                                 

Gene name
RHAG
Definition
(RefSeq) ammonium transporter Rh type A
  KO
K06580  ammonium transporter Rh
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101093607 (RHAG)
   04090 CD molecules [BR:fca04090]
    101093607 (RHAG)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   101093607 (RHAG)
CD molecules [BR:fca04090]
 Proteins
  101093607 (RHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 101093607
NCBI-ProteinID: XP_006931856
Ensembl: ENSFCAG00000001258
LinkDB All DBs
Position
B2
AA seq 415 aa AA seqDB search
MKLKFPVVAIVLEVAMIILFGYFVEYETEQINLQQPNTTNSTKVDRFLELHSLFQDVHVM
IFVGFGFLMTFLKNYGFSSVGINLLIAALGLQWGTFMWGIVHNHGQKIHIGIKNMINGDL
STATVLISFGAVLGKISPTQMLVMTILEIAAFVGNEYLVGEIFKASDIGASMTIHAFGAY
FGLAVAGILYQPSLRKGHEMEKSAYHSDLFAMIGTLFLWMFWPSFNSVIAETGEKQYMAI
VNTYFSLVACVLTAYAFSSLVEKRGRLDMVHIQNATLAGGVALGTCADMKIHPYGSMIIG
SIAGIVSVFGFKFLTPFFTTKLRIHDTCGVHNVHGLPGVVGGLASIVAIALGASKTSTMA
MQAAALGSSIGTAVVGGLITGLILKFIVRGQPSERNFFDDSVYWEVSKQDNHQHM
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaattccctgtggtggccatcgtcttggaggttgccatgattattttattt
ggatactttgtcgagtatgaaacggagcagatcaatctccagcaacccaacaccaccaac
tcaacaaaagtggacagatttcttgagttacattctctgttccaagatgtacatgtaatg
atatttgttgggtttggcttcctcatgaccttcctgaaaaattatggcttcagtagtgtg
ggcatcaatctactcattgctgctttgggcctccaatggggcacttttatgtgggggatc
gtgcacaaccatggacagaaaattcacattggaatcaaaaacatgataaatggagacctc
agtacagccacagtcttgatttcttttggagctgtcctgggaaaaataagtccaacccaa
atgctggtcatgacaatactagaaattgctgcctttgttggcaatgaatatctggttggt
gagatatttaaggcctctgacatcggagcatcaatgaccatccatgcttttggggcatac
tttggcttggcggtagcaggcatcctgtatcaaccaagcttgagaaaggggcacgagatg
gagaagtctgcgtaccactcagatctgtttgccatgattggaactcttttcctgtggatg
ttttggcccagctttaattcagtcatcgctgaaactggagagaaacagtacatggccatc
gtaaatacatacttctctcttgtcgcctgtgtgctcacagcctatgcattttccagcctt
gttgaaaagagaggcaggcttgatatggttcacattcagaacgcaacccttgctggagga
gttgctttgggcacctgtgcggacatgaagatccacccgtatggttctatgatcattggg
agcattgcaggaattgtctctgtgtttgggttcaagttcctgactccattttttaccact
aaactgaggatccatgatacatgtggtgttcataacgtgcatggcttacctggtgtggta
ggaggcctcgcaagcattgtggcaatagccttgggagcatctaagacgtctaccatggcc
atgcaggcagctgctctaggttcttccatcggaacggcagttgtcggagggctgatcaca
ggtttaattctcaagttcattgtccgtggacaaccatctgagaggaacttctttgatgat
tctgtttattgggaggtcagcaaacaagacaatcatcagcacatgtga

DBGET integrated database retrieval system