KEGG   Felis catus (domestic cat): 101093985Help
Entry
101093985         CDS       T02385                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101093985 (CACNA1E)
   04020 Calcium signaling pathway
    101093985 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101093985 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101093985 (CACNA1E)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101093985 (CACNA1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101093985
NCBI-ProteinID: XP_023103511
Ensembl: ENSFCAG00000015444
LinkDB All DBs
Position
F1
AA seq 2459 aa AA seqDB search
MVPEMRGPSPGHRLPEPAPCPAAGGNPEPWALGRRHRHVLALPEEEAWRPQQCALLEADA
SDEVGMLPASPRAVAAGFDNFFPVQEGEGPGWEGGAALEAGSSPFLPVSPEVMKRRRGGL
IEQRDIIKAHEAHKMQSTPQARRKEWEMARFGEAVVGRPGSGDGDSDQSRNRQGTPVPAS
GPAAAYKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEY
MILATIIANCIVLALEQHLPEDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKG
SYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKS
IMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACFTNSSGILEGFDPPHPCGVQGC
PAGYECKDWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIP
LIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEV
MLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSAKVD
GASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEF
LFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRA
LRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFND
GTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYT
LLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRR
HHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNP
LSPLNPLNAHPSLYRRPRPIEGLGLGLEKCEEERISRGGSLKGDGGDLPSALDNQRSPLS
LGKREPPWLARPCHGNCDSTQQEAGGGETVVTFEDRARHRQSQRRSRHRRVRTEGKEPSS
TSRSRSASQERSLDEEGPTEGEKDREPRASHGGKEPTIQEEERGQDLRRTNSLMVPRGSG
LAGALDEANTPLVQPQPELEMGKDTALTEQEPEGSSEQALLGDVQLDMGRAISQSEPDLS
CVTANTDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIKEEEEEVEKK
QQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAED
PVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGAL
VAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILI
VYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFH
YDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHF
VVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGF
LNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIR
ILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLM
LLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLM
LNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPP
LGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSE
LQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQK
NAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRGGYPSMSPLSPQEIFQLACMDP
ADDGQFQEQQSLEPEVSELKSVQSSNHGIYLPSDTQEHTGSGRASSMPRLTVDPQVVTDP
SSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSD
THRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHESRSPSEGRSQTPNRQG
TGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSMSPPADGSEGGSP
LASQALESPEAGLAESSSSRHVQQGQHASPQRYISEPYLALHEDSHASDCGEEETLTFEA
AVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDLLSDTEEDDKC
NT seq 7380 nt NT seq  +upstreamnt  +downstreamnt
atggtgccggagatgcgtggaccgagcccaggccacaggctgcccgagcccgccccctgc
cccgccgcaggtgggaaccctgagccctgggccttgggccgccgccaccgccacgtccta
gccctgcccgaggaggaggcatggcggccccagcagtgcgccctgctcgaggccgacgcc
tcggacgaggtgggcatgctgcccgcctccccgcgtgccgtcgccgcgggcttcgacaac
ttcttcccggtgcaggagggcgagggccccggctgggagggcggtgcggccctggaagct
ggctccagcccgttcctcccggtgagccccgaggtgatgaagcggcggcgcggggggctc
atcgagcagcgcgacatcatcaaggcccacgaggcgcacaagatgcagagcaccccgcag
gcccggcgcaaggagtgggagatggctcgcttcggggaggcggtggtcggcaggccgggg
tcgggcgatggagactcggaccagagcaggaaccggcaaggaaccccggtgccggcctcg
gggccagcggccgcctacaagcagtcgaaagcgcagagggcgcggactatggctttgtac
aaccccattcccgtccggcagaactgtttcaccgtcaacagatccctgttcatcttcgga
gaagataatattgtcaggaaatacgccaagaagctcatcgattggccgccgtttgagtac
atgattttggccaccatcattgccaactgcattgtcttggccctggaacagcatcttcct
gaggatgacaagaccccgatgtcccgcagactggaaaagacagaaccatatttcattggg
atcttttgctttgaagctggtatcaaaattgtggccctggggttcatcttccataagggc
tcgtacctccgcaatggctggaatgtcatggatttcatcgtggtcctcagtggcatcctg
gctacggcaggaacccacttcaacacacatgtggacctgaggactcttcgggctgtgcgt
gtcctgaggcccctgaagctcgtgtcagggatacctagcctacagattgtgttgaagtcc
atcatgaaggccatggtgcctcttctgcaaattggccttctgctcttctttgccatcttg
atgttcgccatcattggcttggagttctacagtgggaagttgcaccgggcatgtttcacg
aacagttcaggcattttagaaggatttgaccctcctcacccatgtggtgtgcagggctgc
ccagctggttatgaatgcaaggactggattggccccaacgatgggatcacccagtttgat
aacatcctttttgctgtgctgactgtcttccaatgcatcaccatggaaggatggaccacc
gtgctgtacaataccaatgatgccttaggagccacctggaattggctgtacttcatcccc
ctcatcatcattggatccttctttgttctcaacctcgttctgggagtgctttccggggaa
tttgccaaagagagagagagagtggagaaccggagagctttcatgaaattgcggcggcag
cagcagattgagcgtgagctgaatgggtaccgcgcctggatagacaaagcagaggaagtc
atgcttgctgaagaaaataaaaacgctggaacatcagccttagaagtgcttcgaagggca
accatcaaaaggagccggacagaggccatgactcgagactccagcgatgagcactgtgtt
gatatctcctctgtgggcacacctcttgcccgagccagcatcaaaagcgcaaaggtggat
ggggcctcctatttccggcacaaagaaaggcttctgcgcatctctatccgccacatggtc
aaatcccaggtgttttactggattgtgttgagccttgtggctctcaacactgcctgtgtg
gccatcgtccatcacaaccagccccagtggctcacccatctcctctactatgcagaattt
ctgtttctgggactgttcctcttggagatgtccttgaagatgtatggcatggggcctcga
ctttactttcactcttcattcaactgttttgattttggggtcacagtgggcagtatcttt
gaagtggtctgggcaatcttcagacctggtacatcttttggaatcagtgtcttgcgagct
ctccggcttctaagaatatttaaaataaccaagtattgggcatctctgcgaaatctggtg
gtctccttgatgagttctatgaagtctatcatcagtttgctcttcctcctcttcctcttc
atcgttgtctttgctctcctaggaatgcagctgtttgggggaaggtttaactttaatgat
gggactccttcagcaaactttgacacctttccggcagccatcatgactgtattccagatc
ctaacaggtgaggactggaatgaggttatgtacaatgggatccgctcccagggtggagtt
agctcaggcatgtggtcagctatctatttcattgtgctcaccttgtttggaaactacaca
ctgctgaatgtgttcttggccattgctgtagacaatctggccaatgcccaagagctgacc
aaggatgaacaagaagaagaggaggccttcaaccagaaacatgcattgcagaaggccaag
gaggtcagcccgatgtctgcacccaacatgccttctatcgaaagagacagaaggagaaga
caccacatgtcgatgtgggagccacgcagcagccacctgagggagcggaggcgccggcac
cacatgtcagtgtgggagcagcgcaccagccagctgagaaggcacatgcagatgtccagc
caggaggccctcaacaaagaggaggccccaccaatgaaccccctcaatcccctcaacccg
ctgagccccctcaacccactcaacgcccacccgagcctctaccggagacccagacccatt
gagggcctgggcctgggcctggagaaatgtgaggaggagcgcattagccgcggggggtcc
ctcaagggggacggaggggacctgccgagtgccttggacaaccagaggagccccttgtcc
ttgggcaaacgggagccaccatggctggccaggccgtgtcatgggaactgtgattcgacc
cagcaggaggctgggggaggggagactgtggtgaccttcgaggaccgggccaggcacagg
cagagccagcggcgcagcaggcaccgtcgtgtcaggaccgaaggcaaggaaccctcctcc
acctcccggagcaggtctgccagccaggagcggagtctggatgaagaggggcccaccgag
ggggagaaggaccgcgagcccagggccagccacgggggcaaggaacccacaatccaggaa
gaggaaagaggccaagacttaaggaggaccaacagtctgatggtgcccagaggctccggg
ctggcaggagccctcgacgaggccaacacacccttagtccagccgcagccagagttggaa
atggggaaggacacggctctgacagagcaggagccggagggcagcagtgagcaagctctg
ctgggggatgtgcagttggacatgggccgggccatcagtcagagtgagcccgacctctcc
tgtgtcacggccaacacggacaaggccaccactgagagtaccagcgtcaccgtcgccatc
cccgacgtgggccccttggtggactcaactgtggttcacattagcaacaagactgatgga
gaagccagtcctttgaaggaggcagagatcaaagaggaggaggaagaggtagagaagaag
cagcaaaagaaggagaagcgtgagacgggcaaagccatggttccccacagctctatgttc
atcttcagcaccaccaacccgattcgcagggcctgccactacattgtgaacctgcgctac
tttgagatgtgcattctcctggtgatcgcagccagcagcattgccctggcagccgaggac
cctgtcctgaccaactcggagcgcaacaaagtcctgaggtattttgactatgttttcact
ggcgtgttcacctttgagatggttataaagatgatagaccagggcttgatcctgcaggat
gggtcctacttccgagacctatggaacatcctggactttgtggtggtggttggcgcattg
gtggcctttgctttggcgaacgccttaggaactaacaaggggcgggacatcaagaccatc
aaatctctgagggtgctccgagttctgagaccgctgaagaccatcaagcgcttgcccaag
ctcaaggctgtctttgattgcgtggtgacttccttgaagaatgtcttcaacatactcatt
gtctacaagctcttcatgttcatcttcgctgtcatcgcagttcagctcttcaagggaaag
ttcttttattgcacggacagttccaaggacacagagaaggagtgcataggcaactatgta
gatcatgaaaaaaacaagatggaggtgaaaggccgggaatggaagcgccatgaattccac
tacgacaacattatctgggccctgctgaccctcttcactgtctccacaggggaaggatgg
cctcaagtcttacagcattctgtcgatgtgacagaggaagaccgaggaccaagccgcagc
aaccgcatggagatgtccatcttttacgtggtctactttgtggtcttccctttcttcttt
gtcaatatctttgtggctctcatcatcatcaccttccaggagcaaggagacaagatgatg
gaggagtgcagcctggagaagaacgagagggcgtgcatcgacttcgccatcagtgccaaa
cctctcacccgctacatgccgcagaacaggcataccttccagtaccgcgtctggcacttc
gtggtgtcgccgtcctttgagtacaccattatggccatgatcgccttgaacaccgtcgtg
ctgatgatgaagtactactctgctccctgtacctatgaactggccctgaagtacctgaat
attgccttcaccatggtgttttctctggaatgtgtcctaaagatcatcgcgtttggcttc
ttgaactattttcgagatacctggaatatctttgactttatcaccgtgattggcagtatc
acagaaatcattctgacagacagcaagctggtgaacaccagtggcttcaatatgagcttt
ctgaagctcttccgagctgctcgtctcatcaagcttctacgtcagggctacaccatccgt
attttactttggacttttgtacagtcctttaaggccctcccctacgtctgccttttgatt
gccatgcttttcttcatctatgccatcatcgggatgcaggtattcggaaacataaaatta
gatgaggagagtcacatcaaccgacacaacaacttccggagtttcttcgggtccctcatg
ttactcttcaggagtgccacaggtgaggcctggcaggagataatgctgtcgtgcctcggg
gagaaaggctgtgagcccgacaccactgcgccatcagggcagaatgagaatgagcgctgt
ggcaccgatctggcctatgtttactttgtctccttcatcttcttctgctccttcttgatg
ctcaacctgtttgtggccgtcatcatggacaactttgagtacctgactcgggactcatcc
atcctagggccccaccacttggacgagtttgtccgcgtctgggcagaatatgacagagct
gcatgtggccgcatccattacactgagatgtatgaaatgctgactctcatgtcaccaccg
ctaggcctcggcaagagatgtccctccaaagtggcatataagaggttggtcctgatgaat
atgccagtagctgaggacatgacagtccacttcacctccacactcatggctctgatacgg
acagcactggacatcaaaatcgccaaaggtggtgcagacagacagcagctagactcagaa
ctacaaaaggagaccctggccatctggcctcacctatcccagaagatgctagatctgctc
gtgcccatgcccaaagcctctgacctgactgtgggcaaaatctatgcagcaatgatgatc
atggactactataaacagagtaaggtgaagaagcagaggcagcagctggaggaacagaaa
aacgcacccatgttccagcgcatggagccttcatctctgcctcaggagatcattgctaat
gccaaagccctgccttatctccagcaggaccctgtctcaggcttgagtggccgtggtgga
tacccttcgatgagtccgctctccccccaggaaatattccagttggcttgtatggaccca
gccgatgatggacagtttcaggaacagcagtctctggagccagaggttagtgaattaaaa
agcgtgcagtcctctaaccatggcatctaccttccttcggacacccaggagcatacggga
tctgggagggcatcctctatgccacgcctgactgtggatccccaggtggtgacagaccct
agctccatgagacgctcattttccaccattcgggataagcgttcaaattcctcatggttg
gaggaattctctatggagagaagcagtgaaaacacctacaagtcacgtcgccggagttac
cactcctccctgagactgtcagctcatcgcctgaattctgactcaggccacaagtctgac
acccaccgctcagggggcagagagcggggacgttcaaaagagcgaaagcatcttctctct
cccgatgtctcccgctgcaactcagaggagcgagggacccaggctgactgggagtccccc
gagcgccatgagtccaggtctcccagcgagggcaggtcacagacccccaacagacagggc
acgggttccctgagtgagagctccatcccctccatctctgacaccagcactccgagacga
agtcgccggcagctcccgcccgtgccaccaaagcctcggcccctcctttcctacagctcc
ctgattcgacacaccgggagcatgtctccaccggctgatggaagcgagggtggctctccg
ctggcctcccaagccctggagagccctgaggccggcctggcggaatcttccagctcccgg
cacgtacagcagggtcagcacgcctccccacagcgctacatctccgagccctacctggcc
ctgcacgaagactcccacgcctcggactgtggcgaggaggagacgctcacctttgaagca
gctgtggccaccagcctgggccgctccaacaccatcggctcggccccaccgctgcggcac
agctggcagatgcccaacgggcactatcgacggcggaggcgcggggggcccgggccaggt
gtgatgtgtggggctgtcagcgacctcctgagtgacacggaagaggacgacaagtgctag

DBGET integrated database retrieval system