KEGG   Felis catus (domestic cat): 101094061Help
Entry
101094061         CDS       T02385                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04614  Renin-angiotensin system
fca04924  Renin secretion
fca05142  Chagas disease (American trypanosomiasis)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101094061 (ACE)
   04614 Renin-angiotensin system
    101094061 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101094061 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101094061 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101094061 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094061 (ACE)
   04090 CD Molecules [BR:fca04090]
    101094061 (ACE)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101094061 (ACE)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M2
   101094061 (ACE)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101094061 (ACE)
CD molecules [BR:fca04090]
 Proteins
  101094061 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 101094061
NCBI-ProteinID: XP_023100343
LinkDB All DBs
Position
E1
AA seq 1316 aa AA seqDB search
MGAASGRPRRGPPPPLPLLLLLLPPLPLLLPPPPAALALDPELHPGNFSADEAGAQLFVK
SFNSSAELVMYQSTVASWEYDTNITEENARLQEEAALLNQEFAEIWGQKAKDLYDPIWQN
FSDPILRRVISGVRTLGPANLPVAKRQQYNSLLSNMNRIYSTAKVCYYPNKTAICWSLDP
ELTHIMAISRSYSVLLYAWEGWHNAVGIPLKPLYQNFTALSNEAYKQDGFSDTGAYWRSW
YDSPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSW
DNLYDMVVPFPNKPSLDVTSTMVKKGWNITHMFRVAEEFFTSLGLLPMPPEFWTRSMLEK
PTDGRQVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDQPVSLRQ
GANPGFHEAIGDVLALSVSTPEHLYKIGLLDNVSNDMESDINYLLKMALEKIAFLPFGYL
VDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICAPIARNETHFDAGAKFHVPNVTPYIRY
FVSFVLQFQFHQALCKEAGHQGPLHKCDIYQSTQAGAKLREALRSGSSRPWQEVLKEAIG
SDTLDAQPLLNYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPVPHNYPQDIGLVTDEVEAR
KFVEEYDRRSQVIWNEYAEANWNYNTNITTEASKILLQKNIQMANHTLKFGTWARQFDMT
SFQNDSIKRMLKKIQDLERAALPAKELEEYNQILLDMETTYSVASVCHANGTCLQLEPDL
TNLMATSRKYEDLLWAWKSWRDKVGRAILPFFPKYVELANKAAKLNGYEDAGDSWRAMYE
MPTLEHDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTWSN
IYDLVVPFPSAPKIDATEAMIKQGWTPRRMFEEADNFFTSLGLLPVPFEFWNKSMLEKPT
DGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGA
NPGFHEAIGDVLALSVSTPKHLHSINLLSSEGGGYEQDINFLMKMALDKIAFVPFSYLVD
QWRWRVFDGSITKENYNQEWWNLRLKYQGLCPPVARAQGDFDPGAKFHVPSSVPYIRYFV
GFVIQFQFHEALCQAAGHKGPLHTCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQT
NMSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSALSEGPVPGNGRVNFLGLDL
EEQQARVGQWVLLFLGITLLVATLVLTQRLFSIRRHSLHQPHHGPQFGSEVELRHS
NT seq 3951 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccgtccccggcgggggccgccgccgccgctgccgctgctgctg
ctgctgctgccgccgctgccgctgctgctgccgccgccgcccgccgccctggcgctcgac
cccgagctgcatcccggaaacttttccgccgacgaggccggggcgcagctcttcgtgaag
agcttcaactcgagcgccgagctggtgatgtaccagagcacggtcgccagctgggagtac
gacaccaacatcaccgaggagaacgcgcggctccaggaggaagcagccctgctcaaccag
gagtttgctgagatctggggccagaaggctaaggacctgtatgacccaatctggcagaac
ttcagtgacccgatcctgcgaagggtcatcagtggtgtgcgcaccctgggccctgccaac
ctgcctgtggcaaagcggcagcagtacaactctctgctaagcaacatgaacaggatctat
tccacggccaaggtctgctactatcccaacaagactgccatctgctggtccctggaccca
gagctcacccacatcatggctatatcaagaagctactccgtgctgctctatgcctgggag
ggctggcacaatgctgtgggcatcccgctgaaacccctgtaccagaacttcactgccctc
agcaatgaggcctacaagcaggatggcttctcagacacgggggcctactggcgctcctgg
tatgactcacccaccttcgtggaggatctggaacacctctaccatcaagtagagcccctc
tacctgaacctccatgcctatgtccgccgtgcgctgcaccgccgatatggggacagatac
atcaacctcaggggacccatccctgctcacctgctgggggacatgtgggcccagagctgg
gacaatctctatgatatggtggtgccttttcctaacaagcccagtctcgacgtgaccagc
actatggtgaagaagggctggaacattacgcacatgttccgagtggcagaggaattcttc
acctccctggggctcttgcccatgcctcctgagttttggacaaggtccatgctggagaaa
ccaaccgacgggcgtcaggtggtgtgccacgcctctgcctgggacttctacaacaggaaa
gacttcaggatcaagcagtgcacgcgggtcactatggaccagctgtccacggtgcaccac
gagatgggccacgtgcagtactatctgcagtacaaggaccagcctgtctccctgcgccaa
ggggccaaccctggcttccacgaggccatcggggatgtgctggcgctctccgtctccact
cctgaacatctgtacaaaattggcctgctggacaatgtcagcaatgacatggaaagtgac
atcaattacttgttaaagatggcactggaaaaaattgccttcctgccctttggctacttg
gtggaccagtggcgctggggggtctttagtgggcgaacccccccttcccgctacaacttt
gactggtggtatcttcgaaccaagtatcagggaatctgtgctccaattgcccgaaatgaa
acacactttgatgccggagctaagtttcatgtcccaaatgtaacaccgtacatcaggtac
tttgtgagttttgtgctgcaattccagttccatcaagccctgtgcaaggaggcgggtcac
caaggcccactgcacaagtgcgacatctaccagtccacccaggcgggggccaagctcagg
gaggcactgcggtcaggctcctcacggccctggcaggaggtgctaaaggaggcgattggc
tcagacacactggatgctcaacctctgctcaactacttccagccggtcagccagtggctg
caggagcagaatcagcgcaacggcgaagtgctggggtggccggaataccagtggcggcca
ccagtaccccacaattacccacaggacattggcctggtgaccgatgaggtggaggctaga
aagtttgtggaggaatatgaccgaagatcccaggtgatatggaatgagtatgctgaggct
aactggaactataacaccaacatcaccacagaggccagcaagatcctgctacagaagaac
atacagatggcaaaccacaccttgaagttcggcacctgggccaggcagtttgatatgacc
agcttccagaatgacagcattaagcggatgctgaagaagattcaggacctagagcgggca
gcactgcctgccaaggagctggaggagtacaaccagatcctgctggacatggaaaccact
tacagcgtggcctctgtgtgccacgccaatggcacttgtctgcagctggagcctgatctg
acgaatctgatggccacgtcccggaaatatgaagatctgttgtgggcctggaagagctgg
cgagacaaggtggggagagcaatcctcccctttttccccaaatatgtggaacttgccaac
aaggccgccaagctcaatggctacgaagatgcaggtgactcctggagagccatgtacgag
atgccaaccctggaacacgacctggagcagctctaccaggagctgcagccgctctacctg
aacctgcacgcctacgtgcgccgggccctgcaccgccactacgggccccaacacatcaac
ctggagggccccattccagctcacctgctggggaacatgtgggctcagacctggtccaac
atctatgacttggtggtgcctttcccttcagcccccaagatagatgccacagaggccatg
ataaagcagggctggacacccagaaggatgtttgaggaagcggacaatttcttcacctcc
ctggggctgttgcctgtgccctttgagttctggaacaagtcaatgctagaaaagccgact
gacgggcgggaagtagtgtgccacgcctctgcctgggacttctacaatggcaaggacttc
aggatcaagcagtgcaccactgtgaacatggaggacctggtggtggcccatcatgaaatg
ggccacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggtgcc
aaccctggctttcacgaggccattggagatgtgctggccctctcagtgtctacccccaag
cacctccacagtatcaacctgctgagtagcgagggtggcggctatgagcaagacatcaat
tttctgatgaagatggcactcgacaagatcgcctttgtccccttcagctacctcgtcgac
cagtggcgctggagggtatttgatggaagcatcaccaaggagaactacaaccaagagtgg
tggaacctcaggctaaagtaccagggcctctgccccccagtggcccgggctcaaggggac
tttgacccaggggccaagttccacgttccttcaagtgtgccttatatcaggtactttgtc
ggctttgtcattcagttccagttccacgaagctctgtgtcaggcagctggccacaagggc
cccttgcacacatgtgacatctaccagtctaaggaggcaggaaagcgcctggcggatgcc
atgaaactgggcttcagtaagccatggccagaagccatgaagctgatcacaggccagacc
aacatgtctgcgtccgccatgatgaactacttcaagccgctgctggactggcttctcact
gaaaatgggcggcacggggagaagctgggctggcctcagtacaactggacaccaaactct
gctctctcagaaggccccgtcccgggcaacggccgtgtcaacttcctgggcctggacctg
gaggagcagcaggcccgcgtgggccagtgggtgctgctcttcctgggcataaccctgctg
gtggccaccttggtcctcacccagcggctcttcagcatccgccgtcacagcctccaccag
ccccaccatgggccccagtttggttccgaggtggagctgaggcactcctga

DBGET integrated database retrieval system