KEGG   Felis catus (domestic cat): 101094204Help
Entry
101094204         CDS       T02385                                 

Gene name
ME3
Definition
(RefSeq) NADP-dependent malic enzyme, mitochondrial isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00620  Pyruvate metabolism
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101094204 (ME3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101094204 (ME3)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     101094204 (ME3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 101094204
NCBI-ProteinID: XP_011284866
Ensembl: ENSFCAG00000011823
LinkDB All DBs
Position
D1
AA seq 604 aa AA seqDB search
MGAALGTSARLAPLRGRACGAVPRWAPSAPARACHSKPGAARPVPLKKRGYDVTRNPHLN
KGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKL
FYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNI
KAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVSPQQCLPVLLDVGTNNEELLRD
PLYIGLKHQRVRGKEYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCM
FNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKA
EATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGR
TFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLST
IRDVSLRIAIKVLDFAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMN
VQTV
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgcgctgggcacgagcgcacggctggcgcccctgcggggccgggcctgcggc
gccgtcccgcgctgggcgccctctgcacccgcccgagcctgccactccaagcccggcgcg
gcgcgcccggtgcccctgaagaagcgcggttacgatgttaccaggaacccgcatctcaac
aaggggatggcctttacacttgaagaaaggttgcagcttggaatccacggcctgattccc
ccctgcttcctgagccaggacgtccagcttctccggatcatgagatactacgagcggcag
cagagcgacctggacaagtacatcattcttatgacactccaggaccggaacgagaagctc
ttctaccgagtgctgacgtcagacgtggagaaattcatgcccatcgtgtacacccccacc
gtgggactggcctgtcagcactatggcctgaccttccgcaggccccgggggctgtttatc
accattcatgacaagggccaccttgcaacaatgctgaactcttggccagaagacaatatt
aaggccgtggtggtaactgatggggagcgcatcctgggcctaggcgatctgggctgctac
ggcatgggcatccccgtgggcaagctggccctgtacacagcgtgcggaggggtcagcccg
cagcagtgcctcccagtcctgctggacgtcggcaccaacaatgaggagctgctcagagac
cccctgtacatcgggttgaaacaccagcgtgtgcgtgggaaggagtacgatgacctgctg
gacgagttcatgcaggctgtgacagacaagtttggaataaattgcctcatccagtttgaa
gactttgccaatgccaatgccttccgcctgctcaacaaataccgcaacaagtattgcatg
ttcaatgatgacatccaaggcacagcctctgtcgctgtagcggggatcctggctgctctg
cgaatcaccaagaacaagctctccaatcatgtgtttgttttccaaggcgcaggtgaggca
gccatgggcatcgcccacctccttgtcatggctctagagaaagaaggtgtacccaaggca
gaggccacaaggaagatctggatggtggactccaagggactcattgtcaaggggaggagc
cacctgaaccatgagaaggagatgtttgcccaggaccatcctgaagtgaactccctggag
gaggtggtgaggctggtaaagcccacagctatcataggtgttgctgccatcgcaggagcc
ttcacggagcagattctgagggacatggcctccttccacgagcgccctatcatctttgcc
ctgagcaaccccaccagcaaggccgagtgcacggctgagaagtgctaccgggtcactgag
ggccgagggatctttgccagtggaagtccctttaagagcgtgactctggaagatggcagg
accttcattcctgggcaaggaaacaatgcctatgtgttccctggagtggctctgggagtc
attgctggggggatccggcacatcccagatgagatcttcctcctgacggcagagcaaatt
gcccaagaggtctctgagcagcatttgtcccaggggagactgtacccaccactcagcacc
atccgagatgtgtctctgagaatcgccatcaaagtcctcgacttcgcgtacaaacacaac
ctggcctcctactacccagagcccaaggacaaggaggcttttgtaagatccctggtctac
actccagattatgactcctttacactggacagctatacttggcccaaggaagccatgaat
gttcaaacagtctga

DBGET integrated database retrieval system