KEGG   Felis catus (domestic cat): 101094295Help
Entry
101094295         CDS       T02385                                 

Gene name
HKDC1
Definition
(RefSeq) putative hexokinase HKDC1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00010  Glycolysis / Gluconeogenesis
fca00051  Fructose and mannose metabolism
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca00520  Amino sugar and nucleotide sugar metabolism
fca00524  Neomycin, kanamycin and gentamicin biosynthesis
fca01100  Metabolic pathways
fca01200  Carbon metabolism
fca04066  HIF-1 signaling pathway
fca04910  Insulin signaling pathway
fca04930  Type II diabetes mellitus
fca04973  Carbohydrate digestion and absorption
fca05230  Central carbon metabolism in cancer
Module
fca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fca_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101094295 (HKDC1)
   00051 Fructose and mannose metabolism
    101094295 (HKDC1)
   00052 Galactose metabolism
    101094295 (HKDC1)
   00500 Starch and sucrose metabolism
    101094295 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    101094295 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101094295 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101094295 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101094295 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101094295 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101094295 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101094295 (HKDC1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101094295 (HKDC1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101094295 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101094295
NCBI-ProteinID: XP_003994051
Ensembl: ENSFCAG00000004925
UniProt: M3W345
LinkDB All DBs
Position
D2
AA seq 917 aa AA seqDB search
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMQKGLGKDTNPTAS
VKMLPTFVRAIPDGSEKGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGSELFEYVADCLADFMKTKGLKHKKLPLGLTFSFPCRQTKLEEGILISWTKKFKARGV
QDTDVVDCLAKAIKKHKDIDVDILALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDWELDLGSLNPGKQLFEKMISGL
YLGELVRIILLKMAKAGLLFGGKKSSALHTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLVRLRTTVGMDGTVYKIH
PQYPKRLHKVVRKLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
QEQLKAVQGKMRTEFEYGLKRDTHLLAMVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQTSIDKGTLIEWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGT
MMTCGHEDPNCEIGLIAGTGSNMCYMEEMKNIELVEGDEGKMCINTEWGGFGDNGCIDDI
RTQYDEKVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKHGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLYGAGLAAI
VEKRREDQGVENLKVTVGVDGTLYKLHPHFSRILQETVKELAPRCDVTLMLSEDGSGKGA
ALITAVAKRLQQAQKEK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccgtacacttgatggcattttacttcaccaagctgaaggaggatcagatcaag
aaggtggacagattcctgtatcacatgcggctctccgatgagacccttttggacatcatg
gctcggttccaggctgaaatgcagaagggcctggggaaggacaccaaccccacagcctcc
gtgaagatgctgcccacctttgtcagggccattccagatggctcagaaaaaggggagttt
ctttccctggatcttggagggtccaagtttcgagtcttgaaggtgcaggtctctgaagag
gggaaaagaaacgtccagatggagagtcagttctacccaacacccaatgaaattatccga
ggaaacggctcagagctgtttgaatacgtagctgactgtctggcagatttcatgaagacc
aaagggttgaagcataagaaattgccccttggcctaaccttttcttttccctgcagacag
actaaactggaagagggcatcctgatttcatggaccaagaagtttaaggcacgtggagtt
caagacaccgatgtggtggattgtctggccaaagctataaaaaaacacaaggacatagac
gtggacatcctggccttggtcaatgacaccgtggggaccatgatgacgtgcgcctatgat
gatccctactgtgaagttggtgtcatcattggcactggcaccaacgcgtgctacatggag
gacatgagcaacattgacctggtggaaggcgacgagggcaggatgtgcatcaacacggag
tggggggcctttggggacgacggggctctggaagacatccgcaccgagttcgactgggag
ctggaccttggctctctcaaccctgggaagcagctgtttgagaagatgatcagcggcctg
tacctgggtgaacttgtcaggatcatcttgctgaagatggccaaggcaggcctcctgttt
ggcggcaagaaatcctctgctctccacactaagggcaagattgaaacacggcatgtggct
gccatggagaagtataaagaaggcctggccaatacaagagagatcctgacagatctgggc
ctggagccttcggaggccgactgcatcgcagttcagcacgtctgcaccatcgtgtccttc
cgttcagccaatctctgtgcagcggccctggcagccatcctgacacgcctccgggagaac
aagaagctggtgcggctccggaccaccgtgggcatggatggcacggtctacaagatacat
cctcaatacccaaaacgcctgcacaaggtggtgaggaaactggttccgaactgtgatgtc
cgcttcctcttgtcggagagtggaagcaccaagggggctgccatggtgacggcggtggcc
tcccgtgtgcaggcccaacggaagcagattgacaaggtgctggctttgttccagctgact
caagagcaacttaaggctgtgcagggcaagatgcggactgaattcgagtacgggctgaaa
agagacacccacctgctggccatggtcaagatgctgcccacctacgtttgcgggatgccg
gatggtacagagaaaggcaagttccttgccctggatctggggggaaccaacttccgggtc
ctcctggtaaagatcagaagcggacggaggtcggtgcgcatgtacaacaagatcttcgcc
atccccttggagatcatgcagggcaccggcgaggagctgtttgaccacattgtgcagtgc
atcgctgacttcctggactacatgggcctcaagggagcccagctgcccttgggcttcaca
ttctcatttccctgcaggcagacgagcattgacaagggaacactcattgagtggaccaaa
ggcttcaaggccactgactgtgaaggggaagatgtggtggacatgctcagggaagccatc
aagaggagaaatgagtttgacctggacatagttgcgatcgtgaatgacacagtggggacc
atgatgacctgtggacatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggaaatgaagaacatcgagctggtggaaggagacgaaggg
aagatgtgcattaacaccgagtggggagggtttggagataatggctgcatagatgacatc
cggacgcaatatgacgagaaggtggatgaggggtctttgaaccctggcaaacagagatat
gagaaaatgaccagcgggatgtacctgggggagattgtgcggcagatcctgattgacctc
accaagcacggtctccttttccgtgggcagatttcagagcgtctccggaccaggggcatc
tttgaaaccaagttcctgtcccagattgaaagcgatcggctggccctgctccaggtcagg
aggatcctgcagcagcttggcctggacagcacgtgtgaggacagcattgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcagcccagctctatggcgctggcctggcagccatc
gtggagaagaggagggaagaccagggggttgagaacctgaaggtcaccgtgggtgtggat
ggcaccctgtacaagctgcaccctcacttttctcggatattgcaggaaaccgtgaaagaa
ctagctcctcgatgtgatgtgacactcatgctgtcagaagatgggagtggaaagggagct
gctctgatcactgctgtggccaagaggttacagcaggcacagaaggagaaatag

DBGET integrated database retrieval system