KEGG   Felis catus (domestic cat): 101094582Help
Entry
101094582         CDS       T02385                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101094582 (MGAM)
   00500 Starch and sucrose metabolism
    101094582 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101094582 (MGAM)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101094582 (MGAM)
    3.2.1.20  alpha-glucosidase
     101094582 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101094582
NCBI-ProteinID: XP_011278892
Ensembl: ENSFCAG00000024379
UniProt: M3WU26
LinkDB All DBs
Position
A2
AA seq 1824 aa AA seqDB search
MARKKLKYFTSLELMLSVLLLVVFIITIPLFVLSAMDSSESKDPGTSTTPGSAECPVVSE
VERINCIPDQPPTKATCDQRGCCWRPQGTISVPWCYYSKSHGYQMEGDLVKTNAGFTAQL
DRLPSPSLFGNDVNSVLLTAEYQTANRFHFKLTDQSKDRYEVPHEHVQPFKGNAASPLTY
EVVVSKQPFSIKVIRRSNNRVLLDSSIGPLLFADQFLQFSTRLPSPNVYGLGEHVHRQYR
HDMNWKTWSMFARDTIPNGDGTNLYGTQTFFLCLEDASGLSFGLFLMNSNAMEVTLQPAP
AVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYDYGTLQNMRE
VVERNRAAQLPYDVQHADIDYMDERKDFTYDPVNFKGFPEFVKELHNNGQKLVVIVDPAI
SNNSSPSNPYGPYDRGSDAKIWVNVSDGVTPLIGEVWPGKTVFPDYTNPNCAVWWAKEFE
LFYKQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRILDGYLFCRSLCMDAVQH
WGKQYDVHNLYGYSMAIATTQAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNAATWND
LRWSIPGMLEFNLFGIPMVGADICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQD
PASFGATSLLLNSSRHYLTIRYTLLPYLYTLFYWAHSRGDTVARPLLHEFYRDSNTWDVH
QQFLWGPGLLITPVLEEGAEKVMAYMPDAIWYDYETGARTRWRKQRVEMELPGDKIGLHL
RGGHVFPTQQPATTTVVSRRNPLGLIIALDENKEAKGELFWDDGETKDTVASKIYLLCEF
SVTQNRLDVKILQSTYKDPNNLVFKEIKILGIQEPNNVIVKHNGVPSQISPNVTYDSNLQ
VALITEIDLVLGEAYTVEWGLKIRDAEKIDCYPDESGASAENCTARGCAWEAPSSPGVPF
CYFVNDLYSVGDIQYDSRGATATVSLKSSLYASALPSVPVTSLRVQVTYHKNDMVQFKIY
DPNNNRYEVPVPLNIPRVPSSTTEGQLYDVLIKKNPFGIEIRRKSTGSVIWDSQLLGFTF
NDMFIRISTRLPSQYVYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMA
LEQDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGILDFYVFLGPTPELVTQQYTELIGR
PVMVPYWALGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKF
AGFPALITRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKAPNGGGIVWGKVW
PDFPNVVVNGSLDWESQVEQYRAYVAFPDFFRNSTATWWKREMRELYTNPRDPEKSLKFD
GIWIDMNEPASFVNGAVPPGCRDATLNHPPYMPYLESRDMGLSSKTLCMESQQILPDGSR
VRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLK
KSIIGMLEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDPV
SWDATFVNISRSVLKTRYTLLPYLYTLMHMAHTEGSTVVRPLLHEFVSDRVTWDVDRQFL
LGPAFLVSPVLEANARNVTAYFPRARWYDYYTGVDIKARGEWKALLAPLDHINLHIRGGF
ILPWQQPAQNTHLSRQKFIGFKVALDDEGTAKGWLFWDDGQSIDTYGKGLYYLANFSASQ
NTMQSHIIFNKYITDTNPLKLGYVEIWGVGSVSISSVSISASGMVITPTFTYNPASQVLS
VDMTSTDISLHKFVSLTWRSTLNF
NT seq 5475 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaatatttcacgagtttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactattcctctgttcgtgctttcagccatggattcttcagaa
tctaaagatcctgggacgagtaccactccgggttctgctgagtgcccagtggtcagtgaa
gtggaacggataaactgcatccctgaccagccaccaacaaaggccacatgtgatcagcgt
gggtgctgctggagaccgcaggggactataagtgtgccctggtgctactattctaaaagc
catggttatcaaatggagggtgaccttgtaaaaacaaatgcaggattcacagcccagttg
gacaggttgccttctccatccctgtttggaaatgatgtcaacagtgtccttctcacagca
gaataccagacagccaaccgtttccactttaagttgaccgaccagagcaaggacaggtat
gaagtgccccatgaacatgtgcaaccattcaaaggaaatgctgcttctcctttgacctat
gaggttgttgtctccaaacagccatttagcatcaaagtgatcagaagaagcaataatcgt
gtcctgttggactcgagcatcggacccctcctgtttgctgatcagttcctgcagttctcc
acccgactgcccagtcctaatgtgtatggtctgggagaacatgtgcaccgacagtaccgg
catgacatgaattggaagacctggtccatgtttgccagggacacaatccccaatggggat
ggaactaacttgtatggcacacagacattcttcctgtgtcttgaagatgccagcggattg
tcctttggactgtttctgatgaatagcaatgccatggaggttaccctccagcccgcccca
gctgtcacttaccgcaccattggaggcatcctcgacttctatgtgtttttgggaaatact
ccagagcaagttgttcaagaatatctagagctcattggacggccagcccttccctcatac
tgggcacttggatttcatctcagtcggtatgattatggaaccctacagaacatgagagaa
gtcgtggagagaaaccgtgccgcacagctcccttatgatgttcagcatgctgatattgat
tatatggacgagaggaaggacttcacttatgacccagtaaattttaaaggcttccctgag
tttgttaaggagttacacaataacggacagaaattggtcgtcattgtggatccagccatc
tccaacaactcttccccaagcaacccctatggcccgtatgacaggggttcagatgcgaag
atatgggtgaatgtttcagatggggtgactccgctcattggggaggtctggcctggaaaa
actgtgtttcctgattataccaaccccaactgtgctgtttggtgggcaaaggaatttgag
cttttctacaagcaagtggagtttgacggaatctggattgatatgaatgaagtttccaac
ttcgttgatggttctgtttcaggatgttccacgagcaacctaaattaccccccattcact
cccagaatcctggatgggtacctgttctgcaggagcctctgcatggatgccgtgcagcac
tggggcaagcagtacgatgtccacaatctgtacggctactccatggcgattgccaccacg
caagctgtcaagactgtgttccctaataagagaagcttcattataacccgttcgaccttt
gcgggatctggcaagtttgcagcccattggttaggagacaacgcagccacctggaatgat
ctccggtggtctatccctggcatgctcgagttcaacctttttggtatcccaatggtcggt
gctgacatatgtggctttgcattggatgcccctgaggagctctgcaggcggtggatgcag
ctgggagcattttatccattttccaggaatcacaatggccaaggctacaaggcccaggat
cctgcctcctttggagctacctccctgctgctgaattcctccaggcactaccttaccatc
cgctacaccctgttaccctacctctataccctcttctattgggcccacagccggggggac
acggtggccaggccccttctgcatgagttctacagggacagcaacacgtgggatgtacac
caacagtttttatggggacctggcctccttatcactccagttctggaagagggtgcagag
aaagtgatggcttatatgcccgatgccatctggtatgattacgagactggggcccgaacg
agatggaggaagcaaagagtggagatggaacttcctggagacaaaatcggactccacctt
cgcggaggtcatgtattccccacacaacagcccgccaccaccactgtggtcagtcgacgg
aaccctcttggtctcatcatcgccctagatgagaacaaagaagccaaaggcgaacttttc
tgggatgatggggaaactaaagatactgtggccagtaaaatctatctcttatgtgagttt
tctgtcacccaaaaccgcttggatgtgaagattttgcagtcaacctacaaagaccccaat
aatttagtatttaaagagattaaaattcttgggatccaggagcctaacaatgttatagtg
aaacacaatggtgtcccaagtcagatttctcctaatgtcacttatgattctaacctacag
gtcgcccttatcacggaaattgatcttgtcctgggagaagcatacacagtggagtggggc
ctgaagataagggatgcagaaaaaatagactgttatcccgatgagagtggtgcttctgca
gaaaactgtactgcccgtggctgtgcctgggaggcacctagctctcctggggtcccattt
tgttattttgtcaatgacctgtactctgtcggcgacattcagtacgactcacgtggtgcc
actgctaccgtctcattaaagtcttctttatatgcctccgctctgccctcggtacccgtg
acctccctccgtgtgcaagtgacctaccataagaacgacatggtgcagtttaagatttat
gatcctaacaacaatcggtatgaagtcccggtgcctctcaacatacccagggttccatcc
agcaccacagagggtcagctgtatgatgtcctcatcaagaagaatccgtttgggattgaa
attcgccggaagagtacgggctctgtaatttgggactctcagctccttggctttaccttc
aatgacatgttcatccgcatctccactcgccttccctcccaatacgtctatggctttggg
gaaactgagcacacagcctttcggagagacttgaactggcacacgtgggggatgttctcc
cgagaccaacccccggggtacaagaagaattcctatggcgtccacccctactacatggca
ctggagcaggatggcagtgcccatggagtgctcctgctaaacagcaacgccatggatgtg
acattccagcccctgcccgccttgacgtaccgcaccatagggggaattctggacttttat
gtgttcttggggccaactcccgagcttgtcactcagcagtatactgagttgatcggtcgg
ccagtgatggttccttactgggccttgggatttcagctgtgtcgctatggataccagaat
gactctgagattgccagcttgtatgatgagatggtggctgcccagattccttatgacgtt
cagtactcagacatcgactacatggagcggcagctggacttcaccctcagccccaagttt
gcaggatttccagctctgatcactcgcatgaaggccgacgggatgcgggtcatccttatt
ctggacccagccatttctgggaacgagacacagccctatcctgcattcacccggggtgtg
gaggatgatgtcttcatcaaagctccaaatggtggtggcattgtctggggaaaggtgtgg
cctgatttccctaatgtcgttgtaaacgggtctctagactgggagagtcaagtggagcaa
taccgagcttacgtggccttcccagactttttccgtaattcaactgccacatggtggaag
agggagatgcgagaactatataccaatccacgggatccagagaagagcttgaagtttgat
ggcatatggattgatatgaacgagccagcgagttttgtgaatggagcagtgcccccaggc
tgcagggatgccactctgaaccaccctccctatatgccatatttggagtccagggacatg
ggccttagcagcaagaccctgtgcatggagagtcagcagatcctgccagacggctcacgg
gtgcgacactatgacgtgcacagcctgtacggatgggcccagaccagacccacctacgaa
gctgtgcaggaggtgacgggacagagagggatcgtcatcacccgctccacattcccctct
tctggccgctggggaggtcactggctgggagacaacacagctgcctgggaccagctgaag
aagtctatcattggcatgttggagttcagcctctttggcatatcttatacaggagcagat
atttgtggattctttcaagatgctgaatatgagatgtgtgctcgctggatgcaactgggg
gccttttaccccttctcgaggaaccacaacaccattgggaccaggaggcaagaccctgtg
tcctgggatgcaacctttgtgaatatctccagaagtgtcctgaagaccagatataccctg
ttgccatatctctacaccctgatgcacatggcccacacggagggcagcactgtcgtccgg
cctcttctccatgagttcgtgtcagaccgggtgacctgggatgtggaccgtcagtttctg
ctgggcccagccttcctggtcagccctgtcctggaggctaatgcccgaaacgtcactgca
tatttccccagagcccgctggtatgattactacacgggggtggacatcaaagcaagggga
gaatggaaggccttgctggcccctcttgaccacattaatctacacatccgtgggggcttc
atcctgccctggcaacagcctgcacagaacacccacttaagccgtcagaaattcattggc
ttcaaggttgccttggatgatgaggggactgctaaaggttggctcttctgggatgatggg
caaagcattgatacctatggaaaaggactctattacctggccaacttttctgccagccaa
aatactatgcagagtcatataattttcaacaaatatatcaccgatacaaaccctttgaaa
ctgggctacgtggagatctggggagtgggcagcgtctccatttccagtgtcagcatctct
gcgagcggcatggtgatcacacccaccttcacttataaccctgcatcacaggtgttaagc
gttgatatgaccagcacagacatcagcctccataagttcgtctcactgacgtggagaagc
actctgaatttttag

DBGET integrated database retrieval system