KEGG   Felis catus (domestic cat): 101094657
Entry
101094657         CDS       T02385                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X3
  KO
K09850  Ras association domain-containing protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04390  Hippo signaling pathway
fca04392  Hippo signaling pathway - multiple species
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05219  Bladder cancer
fca05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101094657 (RASSF1)
   04390 Hippo signaling pathway
    101094657 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    101094657 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094657 (RASSF1)
   05206 MicroRNAs in cancer
    101094657 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101094657 (RASSF1)
   05223 Non-small cell lung cancer
    101094657 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 101094657
NCBI-ProteinID: XP_003982313
UniProt: M3W6X7
LinkDB
Position
A2
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAETEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQAA
QRGPGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggcgaggcggatgcggggacgccttctttcgagatgacctggagcagcacgacaagc
agtggctactgcagccaggaggactcggactcggagcttgagcagtacttcacggcgcgt
acctcgctggcacgcaggccgcgtcgggaccaggacgagcctgtggagtgggagacacct
gacctttctcaggctgagactgagcagaagatcaaggagtacaatagccagatcaacagc
aacctcttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactg
aagctggtgcgccctgtctcggtgccctccagcaagaagccaccctccttgcaggctgcc
cagcggggcccaggacggggcacagctgtgaggcgccgcacctccttctacttgcccaaa
gatgccgtcaagcacctgcatgtgttgtcacgcacacgggcacgcgaggtcattgaggcc
ctactgcgcaagttcttagtggtggatgacccccgcaagtttgcactctttgagcgggct
gaacgccatggccaagtgtacctccggaagctatcagatgatgagcaacccctgcggctg
cggctccttgcagggcccagcgagaaggccctaagctttgtcctcaaagagaatgattct
ggggaggtaaattgggatgcctttagcatgcctgagctacacaacttcttgcgcatcctg
cagcgggaggaagaggaacacctccgccaaatcctgcaaaagtactcctattgccgtcag
aagatccaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system