KEGG   Felis catus (domestic cat): 101094837Help
Entry
101094837         CDS       T02385                                 

Definition
(RefSeq) probable maltase-glucoamylase 2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00052  Galactose metabolism
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101094837
   00500 Starch and sucrose metabolism
    101094837
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101094837
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101094837
    3.2.1.20  alpha-glucosidase
     101094837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101094837
NCBI-ProteinID: XP_023098058
LinkDB All DBs
Position
A2
AA seq 2612 aa AA seqDB search
MARNLSVLEVLLIIFFLTILALDIFLMLLVLGNPSGRSFVPECPDIPESERIDCVPGHVV
TENVCRWVYKCCWKPVTHTGAPRCFFPRNWGYKVGKRQNDTTGFTAKLKRLPTPSLFGYD
VPDALFAADYQTSNRFHFKITDMDSKRYEVTLENIDLLDRTPKTSNLNYHVEVINEPFSF
KIIRTSNKRILLDTSIGPLQFAHQYLQLSFRLPSTSVYGLGEHVHQQYLHNLTWKTWPIF
TRDATPTEGMINLYGAHTFFLCLEDTSGSSFGVFLLNSDAMEVILQPAPAITYRTIGGIL
DFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYGGINGLRKVVDRNRGAGIP
YDVQYSDIDYMEGGKDFTIDKEAFPRLEDFAKDLHGQGMKYVIMMHPGILNDSKYQPYET
GSEKRVWIWQDNEFAIGQGYPGLTVFPDFSNPVCIEWWREQISEFHKTLEFDGVWIEMDE
VSSFHHGSNRGCESNHLNVPPFTPRVLDGFLSARTLCMDAEFHQGLHYDVHSLYGYSMAK
ATHLAMEGIPLNKSSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIP
MVGANICGYTKNVTEELCRRWMQLGAFYPLSRNHNGPEFVDQDPVAFGSHSLLVNSSKHY
LNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYE
GVDQVKAYIPDAVWYDYETGVAIQWRKQLVEMQLPPDRIGLHLRGGFIFPTQQPSTTTEA
SRKNPLGLIVALDYKREAKGELYWDNGEFKDEKYILYDFSVASNRLQAKVINNNYTDPNN
LTFTDIIILGMDKQPMNFTVSLKNSYRSILNVTYNVSSKVVKITDLKGLVLGQEFSIKWE
LPVSDLEKFNCYPDEPPLTLEHCRKRGCLWEDTTVPGVPTCYYDTIPNYAASNIQYLPTG
ITTDLTHLMTPESTRAATAAGSLSATISFLRLSVIYHTENMLQFKIFDATNKRYEVPVPL
NTPPSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVIWDSQLPGFTFNDTFLSISTRLPS
QYLYGFGETEHTAFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYMALEQDGSAHGVLLL
NSNAMDVSFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQL
SRYGYENDKEISQLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIDQMKKN
GMRFVLILDPAISGNETHYPTFKRGQENDVFIKWPDNNEIVWGKVWPDLPNVNVDATLDH
ETQVKLYRAYVAFPDFLRDSTAAWWKKEIQELYVNPQEPKKSLKFDGLWIDMNEPSNFVD
GSVRGCSDKSLNKPPYMPHLESRDMGLSSKTLCMESQQILPDGSRVRHYDVHSLYGWAQT
RPTYEALQAVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIGMMEFSLFGMS
YTGADICGFFGNAEYEMCLRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMYSRKVLQ
TRYALLPYLYTLMHKAHVEGSTVVRPLLHEFTNDRVTWDIDRQFMLGPAILISPVLESNT
FEIQAYFPRARWYDYSTESGNASTGYWKTLEAPLDHINLHIRGGYILPWQEPAMNTQASR
QKFMGLIVALDDNGKAEGQIFWDDGQSIDTYENGNYFLANFIAAQNILQIQTMHNKYLSD
SNPLKVGYIKIWGVNSTYVTQVTFTYDNKQFMEKNFKSDPYNQILTIQLTDKIINLEKLT
EVTWIYGGPIISTTPMTSTFPTESLHPSTVTTKATTFETVITSSATTTMTLPITTTPFST
SAIEMTTSTTRTTSTAGPDTTTPAATSTSSSSSPSTLPVTTTPFPTSTMEGTTSTTITNS
TTPSSTSTPTASTSTLPITTTPFATSTIEVTTSTAGPDTTTPAATSTTTATTSSSTLITT
TPFPTSTIEVTTSTAGADTPTPAATSTTTSSSPSTLPITTTPFPTSTIEVTTRTTSTAGP
DTTTPAATSTSSSSSPSTLPVTTTPFPTSTMEGTTSTTITNSTTPSSTSTPTASTSTLPI
TTTPFATSTIEVTTSTAGPDTTTPAATSATTSSSPSTLPITTTPFPTSTMNTIEGTTSTA
GADTTTPAPTSTTTSTSTLPITTTPFPTSTIEGTTSTAGPDTPTPAATSTTTTTTTSTNT
LPVTTTPFPTSTIEVTSTTSSDATTPFSTSTPTASTSTSPLQTSTIESTTPLQTSTIELT
TSTTITNTITPSPTSTTASTSTLPVTTTPFPTSASEATTSTSGPDTTTPAPLTMNASTST
LLITTTAFPASTIEFTTSTTYPDTTTPTPTSMTASTTPLPITPTPFPTSITEATANATYS
HVTIPSSTSIPTANTSTLPVTTTPFPTSTIELTTGTIIPNTTTPSPTSTTASTSTLPVTT
TPFPTSTTEVTTSTTHPDTTTPSPTTTANATTTLPIATALFPTSTIEVTTINITDADNSN
SVPYNTTHVSIPNATMASDTLMTVLLDTAAHNQVTANSAVSYLPIVATNATTDSTNITIY
ALNTTILDRTTMDASTPVSTYIANTVNATLVP
NT seq 7839 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaatctgagtgtgttggaagtccttctgatcatcttcttcctaactatactc
gccttagatatcttcttgatgcttttggtgttgggaaatccttcaggtcgttcatttgtt
ccagagtgcccagatatccccgaatcagagaggatagactgtgttcctgggcatgtggtg
acagagaatgtctgcagatgggtctataaatgctgctggaagcctgtgacacatacaggt
gccccgaggtgcttcttccctaggaactggggctataaagttggcaagagacagaatgat
acaacagggtttaccgccaagttgaaaaggctacctaccccatctctgtttggatatgat
gtccctgatgccctcttcgcggctgactatcagacatccaatcgttttcattttaagatc
actgatatggatagcaaacgctatgaagtcacccttgaaaatattgacttgcttgatagg
actcctaagacctctaatttgaactatcacgtagaggtcattaatgagcccttcagcttc
aagatcatacggaccagcaacaaaagaatcttgttggacacgagcatcgggcccctgcag
ttcgcccatcagtacctgcagctgtctttccgactgcccagcacctccgtgtatgggctg
ggagaacacgtgcatcagcagtacctccacaacctgacctggaagacctggcccatcttc
actcgggatgccacccccaccgagggcatgattaatctgtatggagctcatacattcttc
ctgtgcctcgaagacaccagcggctcctcttttggggtttttctgttgaacagtgacgcc
atggaggtcatccttcagcctgctcctgcaatcacttaccgcacgattgggggcatcctt
gacttttatgtattcctgggaaatactccagaacaagtggttcaggaatatctggagctc
attggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcaggaac
tatggcggcatcaatggattgaggaaagttgtggaccgaaatcgtggagctgggatccca
tatgacgtccagtactctgacatagactacatggaagggggaaaggatttcacgattgat
aaagaggctttccctcgtctcgaagattttgccaaagacttgcatggccaaggaatgaaa
tatgtaatcatgatgcatcctggaatattaaatgactctaaataccagccctatgagact
ggaagtgagaagagagtatggatctggcaggacaatgaatttgccattggacagggatat
cccggattgacggtctttcctgattttagcaatccagtttgtattgagtggtggagagag
cagatcagtgaatttcataaaactctcgagtttgatggagtgtggattgaaatggatgaa
gtatccagctttcaccacgggtccaatcgtgggtgtgagtcaaaccacttgaacgttcct
cctttcactcccagagttctggacggcttcctttctgcaagaaccctctgcatggatgca
gaatttcatcagggccttcactatgatgtccacagcttgtatggctactccatggcaaaa
gctacacacttggccatggagggtatccccttgaacaaaagtagcttcatcttatcccgt
tctacttttgctgggtctggcaagtttgctgctcattggttgggagacaatgcagccaca
tgggatgatctccgatggtccatccctagtatccttgagttcaacctatttggtatcccc
atggtaggtgccaacatctgtggttatacaaaaaatgtcacagaggagctctgcagaagg
tggatgcagcttggagccttttatccactatcaaggaatcataatgggcctgagtttgtg
gatcaggatcctgttgcctttggcagccactctctgctggtgaattcctccaaacattat
ctgaacatccgctacactctactcccctatctctacacccttttctaccgagctcacacc
cggggagacaccgtggcaaggccccttgtccatgagttctaccaggacccagctacatgg
gaggtgcacgagcagttcttatgggggcctggacttctcatcacacctgttttatatgag
ggtgtggaccaagtgaaggcatacataccagatgccgtgtggtacgactatgagacagga
gtagctatccagtggaggaaacaactggtagagatgcagctaccacccgataggattgga
cttcacctccgtgggggcttcatatttcccacccagcagcccagcacaaccacagaggcc
agtcggaagaatcccctgggactcattgttgccttggactataagagagaagcgaaggga
gagctgtactgggataatggtgaattcaaagatgaaaagtatattctgtatgatttttct
gtcgcctctaaccgtctacaggcaaaggttataaataataactatacggaccccaacaac
ctcacgtttacagatatcataatcttgggaatggacaagcaacctatgaatttcactgtt
tcattgaagaattcttacaggtccattttaaatgttacctacaatgtttcatcaaaggtg
gtgaagattactgatctcaagggactggtacttggacaagaattctccattaaatgggaa
cttccagtcagtgacctggagaaattcaactgctaccctgatgagccccccctcactctg
gagcattgcaggaagcggggctgcctctgggaggacacaactgttcctggtgtacctacc
tgttactatgacaccatccctaattatgctgccagtaacattcagtacctgcccacgggc
atcaccacagacctcacccacctgatgacccctgaatcaactcgagcagccactgctgct
ggttctctttctgcaacgatcagcttcctccgcctgagtgtcatctaccacacagaaaac
atgctgcagttcaagatctttgatgctactaacaaaaggtacgaggtcccagtgcctctg
aacacgcctccctctcctgttggctcccctgaaaaccgtctgtatgatgtcaggattcag
aacaatccttttgggatccagattcgacgaaaaagctccaacactgtgatttgggactct
cagctccccggctttactttcaacgacacgttcctctccatttcgactcgcctcccctct
cagtacctctacggctttggggagactgagcacacagctttcaggagaaatatgagctgg
aacatgtggggaatgttcgctcgtgatgagccacccgcgtacaagaagaattcctatggc
gtccacccctactacatggcactggagcaggatggcagtgcccatggggtgctcctgcta
aacagcaacgccatggatgtatcattccagcccactcctgccctgacataccgcaccaca
ggagggattttggacttttatatggttttggggccaacccccgagcttgtaactcaacag
tacactgagttgattggtcggccagcaatgactccatactgggccttgggattccagcta
agtcgctatggatacgagaatgataaggagatctcccaattgtatgaggcaatgatggcg
gcccagattccctatgatgtccagcatgtagacatcgattacatggaccggaagctggac
ttcactctcagccccagcttccagaacctcggtctcttgattgaccaaatgaagaaaaat
ggcatgagattcgttctcattctggacccagccatttctggcaacgagacccattatccc
acattcaagagagggcaggaaaacgacgtattcatcaaatggcctgataacaatgaaatc
gtctggggaaaggtttggccagatttgcccaatgtgaatgtggatgccacccttgaccat
gaaactcaggttaagctgtacagagcctacgttgcttttcctgacttcttacgtgatagc
acagctgcatggtggaagaaggaaatacaggagctctatgtgaaccctcaagagccaaag
aagagcttgaagtttgatggattgtggattgacatgaatgagccatcaaactttgtggat
ggatctgtcaggggctgcagcgataaaagtcttaacaagccaccctatatgccacatttg
gagtccagggacatgggccttagcagcaagaccctgtgcatggagagtcagcagatcctg
ccagacggctcacgggtgcgacactatgacgtgcacagcctgtacggatgggcccagacc
agacccacttacgaagccctgcaggcggtgacaggacagcgaggggtcgtcatcacccgc
tccacgttcccttcttctggccgctggggaggtcactggctgggagacaacacggccgcg
tgggaccagctgaggaagtctatcattggcatgatggagttcagtctctttggaatgtct
tatacaggagcagatatttgtgggttctttggaaatgccgaatatgagatgtgtcttcgc
tggatgcagctgggggccttttacccattttccagaaaccacaacaccatcgggacaagg
agacaagatcctgtggcctggaattcaaccttcgagatgtactcaagaaaagtccttcag
accagatacgccctgctgccttacctctacactttgatgcataaagctcacgttgagggc
agcactgtcgtccgaccccttctccatgagtttacaaatgacagagtgacatgggatata
gaccgtcagtttatgttgggtcctgctatcttaatcagccccgtgctggaaagtaacact
tttgagatccaagcttattttcccagagcccgttggtacgactacagcacggaatctggc
aatgcgtcaacaggttactggaaaaccctggaggctccccttgaccacatcaaccttcat
atcagaggaggctacatcctgccttggcaagagcctgcaatgaacactcaggccagtcga
caaaaatttatgggattgattgttgctttggatgacaatgggaaagctgaaggtcagata
ttctgggacgatggacaaagcattgatacctatgaaaatggaaactatttcttggcaaac
tttatagcagctcagaacatattgcaaatccaaaccatgcacaataagtatttgagtgac
tcaaatccactgaaagttggatatattaaaatctggggggtaaattctacttatgtgaca
caagtcacttttacttatgacaacaagcaattcatggagaagaatttcaagagtgaccct
tacaatcagatactaacaattcaattgactgacaagattatcaacctggaaaaactaact
gaggttacctggatatacggtggccctataatttccactacacctatgacaagtaccttc
ccgacagagtctctacatccttctacagttacgactaaggctaccacttttgaaactgtt
atcactagttctgcgactactactatgactcttcctatcacaaccactcctttctcaaca
agtgctattgaaatgacaactagtactaccaggacaactagtactgctggtcctgatacc
actacacctgctgctacaagtactagtagtagtagtagtcctagtactcttcctgtcaca
accactcctttcccaacaagtactatggaaggtacaacaagtactactattactaatagc
actacaccatcctctacaagtacccctactgctagcactagtactctgccgatcacaacc
actccttttgcaacaagtactattgaagtgacaacaagtactgctggtcctgataccact
acacctgctgctacaagtactactactgctactactagtagtagtactcttatcacaacc
actcctttcccaacaagtactattgaagtgacaactagtaccgctggtgctgatacccct
acacctgctgctacaagtactactactagtagtagtcctagtactctgccgatcacaacc
actcctttcccaacaagtactattgaagtgacaacaaggacaactagtactgctggtcct
gataccactacacctgctgctacaagtactagtagtagtagtagtcctagtactcttcct
gtcacaaccactcctttcccaacaagtactatggaaggtacaacaagtactactattact
aatagcactacaccatcctctacaagtacccctactgctagcactagtactctgccgatc
acaaccactccttttgcaacaagtactattgaagtgacaacaagtactgctggtcctgat
accactacacctgctgctacaagtgctactactagtagtagtcctagtactctgccgatc
acaaccactcctttcccaacaagtactatgaatactattgaagggacaactagtactgct
ggtgctgataccaccacacctgcccctacaagcactactactagtactagtactctgcct
atcacaaccactcctttcccaacaagtactattgaagggacaactagtactgctggtcct
gatacccctacacctgctgctacaagtactactactactactactactagtactaatact
cttcctgtcacaaccactcctttcccaacaagtactattgaagtgacaagtactaccagt
tctgatgccactacaccattctctacaagtacccctactgctagcactagtactagtcct
ttgcaaacaagtactattgaaagtaccactcctttgcaaacaagtactattgaacttaca
actagtactactatcactaataccattacaccttcccctacaagtaccactgctagcact
agtactcttcctgtcacaaccactcctttcccaacaagtgctagtgaagctacaactagt
acttctggacctgataccactacacctgcccctctaactatgaatgctagcactagtact
cttcttatcacaaccactgctttcccagcaagtactattgaatttacaaccagtactaca
tatcctgataccacgacacccacccctacaagtatgactgctagtactacacctcttcct
atcactcccactcctttcccaacaagtattactgaagctacagctaatgctacctattct
catgtcactataccatcctctacaagtattcctactgctaacactagtactcttcctgtc
acaaccactccattcccaacaagtactattgaacttacaacaggtactattattcctaat
accactacaccgtcccctacaagtaccactgctagcactagtactcttcctgtcacaacc
actcctttcccaacaagtactactgaagttaccactagtactacccatcctgataccact
acaccttcccctacaactacggctaatgctactactactcttcccattgcaacagctctt
ttccctacaagtactattgaagttacaactataaatattactgatgcagataactctaac
agtgttccatataacactacccatgtttctattccaaatgctacaatggcctcagacaca
ttgatgactgttcttctagacacagcagctcacaatcaggtaacagccaactctgcagtt
agttatttacctattgttgcaactaatgctaccacagatagtacaaatattaccatatat
gctttaaacactaccattcttgatagaacaacaatggatgcttctactcctgtatctacc
tacattgcaaacaccgtaaatgctactctagttccatga

DBGET integrated database retrieval system