KEGG   Felis catus (domestic cat): 101094921
Entry
101094921         CDS       T02385                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04915  Estrogen signaling pathway
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05223  Non-small cell lung cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101094921 (TGFA)
   04012 ErbB signaling pathway
    101094921 (TGFA)
   04014 Ras signaling pathway
    101094921 (TGFA)
   04151 PI3K-Akt signaling pathway
    101094921 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101094921 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094921 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101094921 (TGFA)
   05212 Pancreatic cancer
    101094921 (TGFA)
   05225 Hepatocellular carcinoma
    101094921 (TGFA)
   05214 Glioma
    101094921 (TGFA)
   05211 Renal cell carcinoma
    101094921 (TGFA)
   05215 Prostate cancer
    101094921 (TGFA)
   05223 Non-small cell lung cancer
    101094921 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101094921 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 101094921
NCBI-ProteinID: XP_023107511
LinkDB
Position
A3
AA seq 162 aa
MVPSAGQLALLALGLLLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVL
IHCCQVRKHCEWCQALICRHEKPSALLKGRTACCHSETAYTT
NT seq 489 nt   +upstreamnt  +downstreamnt
atggtcccctcggctggacagctcgccttgctcgcgctgggtcttctgttggctgtgtgc
caggccctggagaacagcacgtccgccctgagtgcagacccgcctgtggccgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
agatttttggtgcaggaagacaagccagcatgtgtctgccattctgggtatgttggtgca
cgctgtgagcatgccgacctcctggctgtggtggccgccagccagaagaagcaagccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcgcatgtgtgctg
atacactgctgccaggtccggaaacactgtgagtggtgccaggccctcatctgccggcac
gagaagcccagtgccctgctgaagggaaggactgcttgctgccactcagagacagcttat
acaacttaa

DBGET integrated database retrieval system