KEGG   Felis catus (domestic cat): 101096181Help
Entry
101096181         CDS       T02385                                 

Gene name
TNK1
Definition
(RefSeq) non-receptor tyrosine-protein kinase TNK1
  KO
K08885  non-receptor tyrosine-protein kinase TNK1 [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101096181 (TNK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101096181 (TNK1)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  ACK family
   101096181 (TNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH3_2 SH3_9 UBA_4 APH SH3_1 HOIP-UBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 101096181
NCBI-ProteinID: XP_003996216
Ensembl: ENSFCAG00000010893
UniProt: A0A2I2V3C5
LinkDB All DBs
Position
E1
AA seq 663 aa AA seqDB search
MLPEASSLWLLRLLRDIQLAQFYRPILEELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLA
EALKRHRSGLKSKNWVYKILGGFVPEQKETTPPSDSPLLSLPEPEGGLKCLIPDGAVCRG
ELLGSGCFGVVHRGLWTLPSGQSVPVAVKSLRVGPEGPVGTELGDFLREVSIMMNLEHPH
VLRLHGLVLGQPLQMVMELAPLGSLHARLAAPAPTPPLPVALLCLFLRQLAGAMAYLGAR
GLVHRDLATRNLLLASPRTIKVADFGLVRPLRGARGRYVMGGPRPIPYAWCAPESLRHGA
FSSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEKDRARLPRPPLCPRALYALALR
CWAPHPADRPSFPHLEGLLQEAWPPEAHCVREVTEPGALRMETGDPITVIEGSPDSTTWK
GQNGRTFKVGSFPASAVTLADSGGSPATRPVHRVSPARGELHQGSTDGDRGKAKLRDLPP
ARGQRRNVPLQRARVISKSLESVLSLGPRPTGGGSSPPELRHARAVTRGPPGLPSCPPFA
SSPSQPSQPPRERPPWPRREPLPSHPPGKPGAGKATVPSGGLLPDPELQRRIMEVELSVH
GVTHQECQAALRATGGDVVSAIRNLKVDQLFHLSSRSRADCRRILEHYQWDLSAASRYVL
ARP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctccctgaggccagctcgctgtggctgctgcgcctgctccgggacatccagctggcc
cagttctaccgacccatcctcgaggaacttaatgttactcggccggagcattttgacttt
gtaaagcctgaggacctggacggcatcggcatgggccggcccgcccagcgcagactggcc
gaagccctgaagagacaccgttccgggcttaagtctaagaactgggtctacaagatcctt
gggggctttgtacctgagcagaaggagaccacccccccttcagacagccccctgttgtcc
ctccctgagcccgaggggggactcaagtgtctgatcccggatggtgctgtgtgcagaggg
gagctgctgggctctggctgctttggagtggtgcaccgagggttatggacactgcccagc
ggtcagagtgtcccagtggctgtcaagtccctccgcgtgggtcctgaaggccccgtgggc
accgagctgggggacttccttcgagaggtgtccatcatgatgaacctggagcacccacac
gtgctgcgtcttcacggcctcgtcctgggccagcctctgcagatggtgatggagctggcg
cccctgggctccctgcacgcgcgcctggccgccccggcccccacgcccccgctgcccgtg
gccctgctctgcctcttcctgcggcagctggcgggggccatggcgtacctgggggcccgg
gggctggtgcaccgagacctcgccacgcgcaacctgctgctggcctccccgcgcacgatc
aaggtggccgacttcgggctggtgcggccgctgcgcggcgcccggggccgctacgtcatg
ggcggaccccgccccatcccctatgcctggtgcgccccagagagcctgcgccacggggcc
ttctcttctgcgtctgacgtgtggatgtttggggtgacgctgtgggagatgttctccggg
ggcgaggagccctgggccggcgtcccgccgtacctcatcctgcagcggctggagaaggac
cgagcccggctgcctcggcctcccctctgccccagggctctctacgccctcgccttgcgc
tgctgggccccccaccctgccgaccggcccagctttccccacctggaggggctgctccaa
gaggcgtggcctcctgaggcacattgtgtgagggaggtcacagagccaggcgccctaagg
atggagactggtgaccccatcaccgtcatcgagggcagcccggactccacgacctggaag
ggccagaatggccgcacattcaaagtgggcagcttcccagcctcagcagtgacactggca
gactcggggggctcgccggccacccgtccggtccacagagtgtcccctgcccggggcgag
ctgcaccagggaagcacggatggggacagagggaaggccaagcttcgggatttgcctccg
gcacggggccagagaaggaacgtgcccctgcagagggcgagagtcatttccaagagcctg
gagtctgttctgtccctgggcccccgccccacagggggtggttccagcccccccgaactt
cgccatgccagagccgtgacccggggaccccctggcctgccatcctgccctccctttgcc
tccagtccttctcagcccagccagccccccagggagcggcctccgtggcccagaagagaa
cccctccccagccaccccccgggaaaacctggagccggcaaagccaccgttccttccgga
ggcctcttgcccgaccccgagttgcagaggaggattatggaggtggagctgagcgttcac
ggagtcacccaccaggagtgccaggcggcgctaagggccactgggggagacgtggtttcc
gccatccggaatctcaaggtggaccagctcttccatctgagcagccggtccagggccgac
tgccgacgcatcctggagcattaccagtgggacctctcggccgccagccgctacgtcctg
gcccggccctga

DBGET integrated database retrieval system