KEGG   Felis catus (domestic cat): 101096419Help
Entry
101096419         CDS       T02385                                 

Gene name
SETD1B
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101096419 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101096419 (SETD1B)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101096419 (SETD1B)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101096419 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     101096419 (SETD1B)
    COMPASS/SET1 complex (yeast)
     101096419 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 101096419
NCBI-ProteinID: XP_023097158
Ensembl: ENSFCAG00000013185
LinkDB All DBs
Position
D3
AA seq 1983 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGSGS
SSVTPNSGGTPFSQDTAYSSSRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTVTFKARRHESKFTDAYNRRHEHHYVHNSCAVTAVAGAPAAFRGSVDLPFGAVSSS
GGSSGPPFKAQPQDSATFAHTPPPAQATPAPGVTFKSAFSPYQTPVPPFPPPPEEPTTTT
TFGARESGEFRRAPAPPPLPPTEPLTKEKPGTPPGPPPPDANSMELGGRPTFGWSPEPCD
SPGTPTLESSPAGLEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSS
QLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGVGPRPPPEP
GPPDPSGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPK
PMVVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPP
XHPAVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQM
QTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQPWPPL
PKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWW
DKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAI
RLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKGV
GVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEE
EGEEEEEEEEDEEEEEEEEEEGPRSQVSSSSTSSTSDKDDDAEDSDEQEESENEDEDIAL
SEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDEEELVAREE
EEEEEEEEEEQEEETTAADESMAPAAPDEDFEEDVATGAPVTESSVMEGEVDIEAEDGAP
EERTSVLEEPPLPVCVEELAGCKEPSEEPGLKQEGARLLSPEPPAGETEARPPPSPEPAP
EDDLEVAPESPTLLSLPLQPPLPPPRPPRPPSPPPEPETPEPPHPPVPLEPPPEEQPPRT
PGLCGSLAKSQSTETVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPSLSSGGLP
RTPGRDFTFTPTFPEPGGPLLLPVCPLPAGRRDERSGPLTSPVLLETGLPLPLPLPLPLP
LALPVPVLRAQTRAPTQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPPGG
ATLGRDLLLLPGQPQTPVFPSTHDPRAVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPT
KLPFKELENQWPSEAIPPGPRGRDEVTEEFMDLAKVRGPWRRPPKKRHEDLVASASPELS
PPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHP
STSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSI
PAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFA
MEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARF
INHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRG
TLN
NT seq 5952 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctctg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagcctggcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtcgttgggatctggaccaaaaac
aaggagctggagctgtcggtgcccaaattcaagatcgatgagttctacgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgagaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccctaagacc
aagaagcacttgggcattgccaaggtggtctttgccacggtcaggggagccaaagaggcg
gttcagcacctgcatagcacttcggtcatgggcaatatcatccacgtggagctggacact
aaaggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacacaccccag
accctcccagtgggtgagctggacgctgtctctccgatcgtgaatgagaccctgcagctg
tcagatgctctgaagcgcctcaaggatggtagtctgtctgcaggctgtggctccggctcc
tcctcggtcacccccaatagtggtgggacacccttctcgcaggacacggcgtactccagc
agccgcctggacacccccaactcctacggacagggcacaccgctcacgccacgtctgggc
acccccttctcgcaggactccagctactccagccgccagcccacaccctcctacctcttc
agccaggaccccacggtgaccttcaaggcccggcgccacgaaagcaagttcacagatgcc
tacaaccgccgccacgagcatcactatgtccacaactcctgtgcggtcaccgcagtggcc
ggggccccagctgccttcaggggctccgtggacctcccgtttggggcagtcagcagcagc
gggggcagcagtggccctccattcaaggcccaaccacaggattcggccacgttcgcccac
actccaccgcctgcccaagcaacccccgctcctggagtcacgttcaagtcggctttctct
ccgtatcagacccctgtgccccctttccccccaccccctgaggagcccaccaccacaacc
acctttggggcccgtgagagtggggaattccggagagcacctgcgcccccacccctgcca
cccaccgaacccctgaccaaggagaagccaggcacaccgcccggcccaccgccccctgat
gccaacagcatggagctgggtggccggccgacctttggctggagccctgagccttgtgac
agtccaggcacacctacgctggagtcctcacctgcggggctggagaagccccacgacagc
ctggattcacgcatagagatgctgctgaaggaacagcgcaccaagctgcccttccttcga
gagcaggactcggatacggagctgcagatggagggcagccccatctcctcctcctcctcc
cagctctccccactggccccctttggcaccaactcccagccaggctttcgaggccccacg
ccaccctcctcacgcccctccagcaccggcctggaggatatcagccccacgccgctaccc
gactcagacgaggatgatgagcttgacctgggcgtggggccccgcccccctccggagcca
ggccccccggacccttctggtcttctgggccagacaactgaggtagccttggacctggct
ggagacaggaccccaacctcagagaagatggatgagggccagcagtcctcgggcgaggac
atggaaatctcggacgatgagatgccctcagcccccatcaccagcgccgactgccccaaa
cccatggtggtgaccccaggggcggcagctgtggcagccccctctgtgctggctccgacg
ctgccgctgcccccaccccccggcttcccgccgctgcccccacccccgccgccgccccca
ccacagccaggcttccccatgcccccgcctctgccgcctcccccgccccccccacccccg
ncccacccagctgtgacagtgccccccccacccctgccagcgcccccccctggtgtccca
cccccacccatcctaccaccgctgccgcccttccctccagggctgtttcccgtgatgcag
gtggacatgagccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatg
caaacgcagatgctgagccgtctgatgactggccagggcgcctgcccctacccgcccttc
atggccgctgctgccgcggccgcctcagccgggctgcagtttgtcaacctgccaccctac
cggggcccgttctccctgagcaacagcggaccgggccgcgggcagccctggccaccgcta
cccaagtttgacccatcagtgccgccaccaggctacgtgccacgccaggaggacccacac
aaggccactgtggatggcgtcctgctggtggtgctcaaagagctgaaggccatcatgaag
cgtgacctgaaccgcaagatggtggaggtggtggctttccgcgccttcgacgagtggtgg
gacaagaaggagcggatggccaaggcctctctgaccccagtgaagtcaggcgagcacaag
gacgaggacaggccaaagcccaaggaccgcatcgcctcgtgcctgctggagtcgtggggc
aagggcgagggcctgggctatgagggcctcggcctgggcatcgggctgcgcggggccatc
cgcctgccctccttcaaggtcaagaggaaggagccgccggacacagcctcttctggtgac
cagaagcgcctgcggccctcaacctctgtggacgaggaagatgaagagtcagagcgagaa
cgggaccgggatatggcggacgccccttgtgagcttgccaagcgggaccccaagggcgtg
ggcgtgcggcgccggccagcccggccgctggagctggacagtggcggggaggaggatgag
aaggagtcactgtcggtgtcctcatcgtcatcggcgtcctcatcctcgggctcctccacg
acctcaccctcatcctcggcctccgacaaggaggagcgggaaagcactgaggaggaagaa
gagggggaggaggaggaggaggaggaggaggatgaagaggaggaagaggaggaggaggag
gaaggccccaggagccaggtctcctcctcctcgacctcatccacatcagataaggatgat
gacgctgaagacagcgatgagcaggaggagtctgagaatgaggacgaggacatagccctg
tcagaggcgagtgagaaggaagaaggggactcggacggagaggagacggtgagcatcgcc
acgtccaaggcgggagctgggtcctccagcgagagttctgagtcttctgagtttgaatca
agctccgagtcctcgtcgtcatcctcagaggatgaagaggagctggtggcaagggaggag
gaggaggaggaagaggaggaggaggaggagcaggaggaggagaccacagcagcagacgag
agtatggctcctgctgctcccgatgaggactttgaggaggatgtggccacgggggcacct
gtgacagagtcctcggtcatggaaggggaggtggacatcgaggctgaggacggagctccc
gaggagcggacttccgtgctggaagagccccccttgcctgtgtgtgtcgaagagctggca
ggctgcaaggagccctcggaggagccgggcctgaagcaagaaggggccaggttgctgtct
ccagagccccctgctggagagacggaggcccggcccccgccttccccggaacctgcccca
gaggatgacctggaagtggcgcccgagtcccctacgctgctctccttaccactgcagccg
ccattgccaccccctcgaccaccccggccgcctagcccaccgccagagcccgagacccca
gagcccccacacccacccgtccctctggagccgcctcccgaggagcagcccccgcgtact
ccgggtctctgtggcagcctggccaagtcacagagcacagagacggtgccggccacgcca
agcggggagcccccgctgtcagggggtagcagtggcctgtcactgagctccccgcaggtg
cccggcagccccttctcctacccatcccagtcccccagcttgagcagcgggggcctcccg
aggacacctggtcgggacttcaccttcacgcccaccttccctgagcccggcggacctctg
ctcctgcctgtctgtcccctcccagctggccggcgcgatgagcggtctggccccctgacc
tccccggtgctcctggagacgggcctgcctctccccctgcccttgcccttgcccctgccc
ctggcattgcccgtccctgtcctgcgggcccagacgcgggcccccacccagctgccgccc
ctgctgcctgcgcccctggccccctgcccaccccctatcaagaggaagccgggcaggccc
cggcgatccccgccggctgtgctctccttggatgggcccttggtccggccaccagggggg
gccaccctcggcagagacctcctgctcctgccaggccagccacagacccctgtcttcccc
agcacccatgacccccgggccgtgaccctggacttccggaacgcggggatcccggccccc
cctccccctctgcccccccagcctcctccgcccccacctccaccccctgttgagcctacc
aagctgccctttaaggagctagagaaccagtggccctccgaggccatccctccaggcccc
cgtgggcgcgatgaggtcaccgaggagttcatggacctggccaaggttcgggggccctgg
cgccggccgcctaaaaagcgccacgaggacctggtggcctcagcctcgcccgagctctca
ccaccgcagcccctcttccggccccggtcggagtttgaggagatgaccatcctgtacgac
atctggaacggtggcatcgacgaggaggacatccgcttcctgtgtgtcacttacgagcgg
ctgctacagcaggacaatggcatggactggctcaacgacacactctgggtctaccatccc
tccaccagcctctcttcagctaagaaaaagaaacgggacgatggcatccgtgagcacgtg
acgggctgtgcccgcagcgagggtttctacaccatcgacaagaaggacaagctcagatac
ctcaacagcagccgcgccagcaccgatgagcccccgacagacacccagggcatgagcatc
ccggcacagccacacgcctccactcgggccggctcggagcggcgttctgaacagcgccgc
ctcctgtcctccttcactggcagctgtgacagtgacctgctcaagttcaaccagctcaag
ttccggaagaagaagctcaaattctgcaagagccacattcacgactggggcctgttcgcc
atggagcccatcgcggctgacgagatggtcattgagtacgtgggccagaacatccgccag
gtgatcgcggacatgcgggaaaagcgttacgaggacgagggcattggcagcagctacatg
ttccgggtggaccacgacaccatcatcgacgccaccaagtgcggcaacttcgcgcgcttc
atcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggagtcgcagaag
aagatcgtcatctactcaaagcagcacatcaacgtcaatgaggagatcacctacgactat
aagttccccatcgaggacgtcaagatcccctgcctgtgcggctccgagaactgccggggg
accctcaactag

DBGET integrated database retrieval system