KEGG   Felis catus (domestic cat): 101096985Help
Entry
101096985         CDS       T02385                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04146  Peroxisome
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101096985 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101096985 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    101096985 (SOD2)
   04213 Longevity regulating pathway - multiple species
    101096985 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    101096985 (SOD2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101096985 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 101096985
NCBI-ProteinID: XP_023110315
LinkDB All DBs
Position
B2
AA seq 222 aa AA seqDB search
MLSRAALSSSRTLVPALGALGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVN
NLNVLEERYREALEKGDVTTQVALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKGELLEA
IKRDFGSFDKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACFNQDPLEGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggcagcgctcagctcgagcaggacgctggtgccggcgctgggggctctg
ggttccaggcagaagcacagcctccccgacttgccgtacgattatggcgccctggagcct
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcgacctacgtgaac
aacctgaacgtcctcgaggagcggtatcgagaggcgctggagaagggtgacgttacaact
caggtagctcttcagcctgggctgaagttcaatggtggaggccatatcaatcattccatc
ttctggacgaacctgagccctaagggtggtggagagcccaaaggggaattgctggaagcc
atcaaacgtgattttggttccttcgacaaatttaaagagaagttgaccactgtatctgtt
ggcgtccaaggctcaggttggggttggcttggtttcaataaggaacagggacgcttgcag
attgctgcttgttttaaccaggatcccctggaaggaacaacaggtcttattccactgctg
gggattgatgtgtgggagcatgcttattaccttcagtataaaaatgtcagaccggattat
ctaaaagctatttggaatgtaatcaactgggagaacgtaactgagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system