KEGG   Felis catus (domestic cat): 101097351Help
Entry
101097351         CDS       T02385                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00480  Glutathione metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01524  Platinum drug resistance
fca05200  Pathways in cancer
fca05204  Chemical carcinogenesis
fca05225  Hepatocellular carcinoma
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101097351 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101097351 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    101097351 (GSTO1)
   00983 Drug metabolism - other enzymes
    101097351 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101097351 (GSTO1)
   05204 Chemical carcinogenesis
    101097351 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    101097351 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101097351 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    101097351 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101097351 (GSTO1)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101097351 (GSTO1)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101097351 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 101097351
NCBI-ProteinID: XP_019669354
UniProt: M3WTU7
LinkDB All DBs
Position
D2
AA seq 241 aa AA seqDB search
MSGGSARSLAKGSAPPGPVPQGLIRVYSMRFCPFAQRTLLVLKAKGIGHEIININLKNKP
EWFFTKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELF
SKVPPLVTSFIRRQNNEDGSGLKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPW
FERLEVLELNECVDHTPKLKLWMAAMREDPAVSSLLIEAKAFRGFLDLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggagggtcagccaggagcctagcgaagggaagcgcgcccccggggccggtcccc
cagggcctgatccgcgtctacagcatgaggttctgcccgttcgcccagaggacgctcctg
gtcctgaaggccaagggaattgggcatgaaatcatcaacatcaacctgaaaaataagcct
gagtggttctttacgaagaatccctttggtctggtgccagttctggaaaacagtcagggt
caactgatctatgaatctgccattacttgtgagtacctggatgaagcatatccagggaag
aagctgttgccagatgacccctatgagaaagcttgccaaaagatggtctttgagttattt
tctaaggttccccctttggtaacaagcttcattagaagacaaaataatgaagacggctct
ggcctaaaagaagaattgcgtaaagaattcagcaagttagaggaggttctgaccaataag
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaacggctcgaagttctggagttaaatgagtgtgtagatcacactccaaaacttaag
ctctggatggcagccatgagggaagatcctgcagtgtcctccctcctcattgaggcgaag
gcctttcgaggtttcttagatctctacttgcagaacagccctgaggcctgtgattatggg
ctctga

DBGET integrated database retrieval system