KEGG   Felis catus (domestic cat): 101097673Help
Entry
101097673         CDS       T02385                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00512  Mucin type O-glycan biosynthesis
fca01100  Metabolic pathways
Module
fca_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101097673 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fca01003]
    101097673 (GALNT9)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101097673 (GALNT9)
Glycosyltransferases [BR:fca01003]
 O-Glycan biosynthesis
  Mucin-type
   101097673 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101097673
NCBI-ProteinID: XP_023097016
LinkDB All DBs
Position
D3
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIIVFSVYCRLQDRSEGLVQTVRSTDRRVRSRHAKAGALAD
REAILERLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGMAATLREDSQETESKYEEYGY
NAQLSDRISLDRTIPDYRPKKCRQVTHTADLPQISVVFIFVNEALSVILRSVHSVVNRTP
SRLLKEVILVDDNSDSAELKTSLDQYVNRRYPGLVKIVRNSRREGLIRARLQGWKAATAP
VVGFFDAHVEFGTGWAEPALTRIQEDRRRIVLPAIDNIKYDTFEVQQYASAAHGYNWGLW
CMYIIPPQDWLDRGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERSKKPYNNDIDYYAKRNALRAAEVWMDSFKSHVYMAWNIP
MTNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRTYNDTLTYGEVRNSKASGYCLD
QGAEDDDHAILYPCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRSRVPALKT
CEDVARPAQRLWDFTQSGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWTIRSWLK
RGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtcaacatcctggtgttcgtgggc
atcatcgtcttctccgtgtactgccgcctgcaggaccgctccgaggggctggtgcagacc
gtgcgcagcaccgaccgccgggtgcgcagccggcacgccaaggcgggtgcgctcgccgac
cgcgaagccatcctggagcgtctggaccacctggaggaggtggtctacaaccaactgaat
ggcctcgccaagcccatcggcctggtggaggggcctgggggcctgggccagggcggcatg
gcggccaccctgcgtgaggacagccaggagacagaaagcaaatacgaggaatacgggtac
aacgcgcagctcagcgaccgcatctccctggacaggaccatcccggactacaggcccaaa
aagtgcagacaggtgacccacaccgccgacctgccccagatctccgtggtcttcatcttc
gtcaacgaggccctctccgtcatcctgcgctccgtgcacagcgtggtcaaccgcacgccc
tcgcggctcctcaaggaggtcatcctggtggacgacaacagtgacagcgcggagctcaag
accagtctggaccagtacgtcaacaggagatacccgggcctggtgaagatcgttcgcaac
agccgtcgggaaggcttgatccgggcccgactgcagggctggaaggcggccacggccccc
gtggtcggcttcttcgacgcccacgtggagttcggcacgggctgggccgagcccgcgctc
acgcggatccaggaggaccgccggcgcatcgtcctgcccgccatcgacaacatcaagtac
gacacgttcgaggtacagcagtatgccagcgcggcccacggctacaactggggcctctgg
tgcatgtacatcatccccccccaggactggctggaccgcggtgacgaggcggcgcccatc
aggacccccgccatgattggctgctcgttcgtggtggaccgggagtactttggggacatc
ggcctgctggacccgggcatggaagtgtatggtggagagaacatcgagctgggcatgagg
gtgtggcagtgtggcggcagcatggaggtgctcccctgctcccgcgtggcccacatcgag
cgcagcaagaagccctacaacaacgacatcgactactacgccaagcgcaacgccctgcgg
gcagcggaggtgtggatggacagcttcaagtcccacgtgtacatggcctggaacatcccc
atgaccaacccaggcgtggacttcggggacgtgtctgagcggctggcgcttcgccagagg
ctgaaatgccgcagcttcaagtggtacctagagaacgtgtacccggagatgcggacctac
aacgacaccctcacgtacggagaggtgagaaacagcaaagccagtggctactgcctggac
cagggagcggaagatgacgaccacgcgatcctctacccctgccacgggatgtcctctcag
ctggtgcgctacagcgctgaggggttgctgcagctgggccccctgggctccaccgccttc
ctgcccgactccaagtgcctggtggacgacggcaggagccgcgtgcccgccctgaaaacg
tgtgaggacgtggcccggccagcgcagcggctgtgggacttcacccagagcggccctatc
gtgagtcgagacacaggcaggtgcctggaggtggaaatgtccaaggacgccaacttcggg
ctgcggctggtggtacagagatgctcggggcagaagtggaccatcaggagctggctcaag
cgcgggcgacactga

DBGET integrated database retrieval system