KEGG   Felis catus (domestic cat): 101097931Help
Entry
101097931         CDS       T02385                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3 isoform X1
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca03410  Base excision repair
Module
fca_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101097931 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fca03400]
    101097931 (LIG3)
Enzymes [BR:fca01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101097931 (LIG3)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     101097931 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N LIG3_BRCT zf-PARP DNA_ligase_A_C BRCT_2 RNA_ligase mRNA_cap_enzyme Synaptonemal_3
Motif
Other DBs
NCBI-GeneID: 101097931
NCBI-ProteinID: XP_003996610
Ensembl: ENSFCAG00000000249
LinkDB All DBs
Position
E1
AA seq 1007 aa AA seqDB search
MPLDESAHFVCMTLTFKILFLPTLRALGRKELCLFGEQHRWPDRRQFSHWSETELFHGHG
LLQRRKAVLSSQKGGLRPRATRLVFLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKC
KEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEE
LEDNEKEQISQHIADLSSKATSTPKKKAVVQAKLTATGQVTSPVKGASFVTNTNPRKFSG
FAAKPNNSGEARSSPTPKASLSSSRCDPKHKDCLLREFRKLCAMVAENPSYNTKTQIIQD
FLRKGSAGDGFHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNPDDMARDLEQG
DVSETIRVFFEQSKSFPPAAKSLLTIQEVDAFLLCLSKLTKEDEQQQALQDIASRCTAND
LKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLRNEQEVEKEPGRR
RALSVQASLMTPVQPMLAEACKSIEHAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSR
SLKPVLPHKVAHFKDYIPQAFPGGHSMILDSEVLLIDTKTGKPLPFGTLGVHKKAAFQDA
NVCLFVFDCIYFNDISLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKASDLADMINR
VIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMM
SIFLMGCYDPGSQKWCTVTKCSGGHDDATLARLQKELDMVKISKDPSKIPSWLKINKIYY
PDFIVPDPKKAAVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATDLPKLKEL
YQLSKERADFTVAAGDEGSSTTGGSSGENEVTSRPASRASPKQPSTSAKKAGGRRSSPNS
RGGSKPTAKPPPVRVGEKRKAPDEPPGQAKVLLDIFTGVRLYLPPSTPDFSRLRRYFVAF
DGDLVQEFDMASATHVLGSRDENPEAQRVSPEWIWACIRKRRLVAPC
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgccccttgatgaatctgcgcactttgtctgtatgactttgactttcaagatcctcttc
ctcccaaccctccgcgcactcgggcgaaaagaactctgcctcttcggggaacaacatcgc
tggcctgacagaagacagttcagccattggtcagaaacagagctgtttcatgggcacggc
ctcctccagagaagaaaggctgttctgtcatcccagaaaggcggtctaagaccacgtgcc
acccgccttgttttcttgccagggtcgcatgtgggactctgcagtggcccctgtgagatg
gccgagcaacggttctgtgtggactacgccaagcgtggcaccgccggctgcaaaaagtgc
aaggaaaagatcgtgaagggcgtatgccggatcggcaaagtggtgcccaaccccttctca
gagtccgggggcgatatgaaagagtggtatcacattaaatgcatgttcgagaaactggag
cgggcccgggccaccacaaaaaaaattgaggacctcaccgagctggaaggctgggaagag
ctggaagataatgagaaggaacagataagccagcacattgcagatttgtcttccaaggca
acaagcacaccaaagaagaaagctgttgtccaggctaagctgacagccactggccaggtg
acgtctccagtgaaaggtgcctcatttgtcaccaataccaatcctcggaaattttctggt
tttgcagccaagcccaacaactctggggaagcccgctcaagccctacccctaaggcaagc
ctgtcctcaagcagatgtgaccccaagcacaaggattgtctgctacgtgagtttcggaag
ttgtgtgccatggtggctgaaaatcctagctacaacacgaagacccagatcatacaggac
ttccttcggaaaggttcagcaggagatggtttccacggtgacgtgtacctaacagtgaag
ctgctgctgccaggtgttattaagagtgtttacaacttgaacgataagcagattgtgaag
cttttcagccgcatttttaactgcaacccagatgatatggcacgagacctagagcagggt
gacgtgtcagagacgatcagagtcttctttgagcagagcaagtctttccctccagctgcc
aagagcctcctcaccatccaagaggtagatgcgttcctcctttgcctctccaagctcacc
aaggaggatgagcaacagcaggccctgcaggacatcgcgtccaggtgtacagccaacgac
cttaagtgcatcatcagattgatcaaacatgacctgaagatgaactcaggtgcaaaacac
gtgttagatgcccttgaccccaatgcctatgaagccttcaaagcctcacgcaacctgcag
gacgtggtggagcgagtcctccgcaatgagcaggaggtggagaaggagccaggccggaga
cgagctctgagtgtccaggcttcactgatgacgccagtgcagcccatgctggccgaggcc
tgcaagtccatcgaacatgcgatgaagaagtgtcctaatggcatgttctctgagatcaag
tatgacggggagcgagtccaggtgcataagaacggagaccacttcagctacttcagccgc
agcctcaagcccgtcctgcctcacaaggtggcccactttaaggactatatcccccaggct
ttccctgggggccacagcatgatcttggactctgaggtgctcctgatcgacactaagaca
ggcaaaccgttgccctttgggactcttggggtgcacaagaaagctgccttccaggatgct
aacgtctgcctgtttgtttttgattgtatctacttcaatgacatcagcttgatggacagg
cctctgtgtgagcggcggaagtttcttcatgataacatggttgaaattcccaaccggatc
atgttctcagaaatgaagcaagtcactaaagcttcggacttggccgacatgataaaccgg
gtcatccgagaggggttggaagggctggtgctgaaggacgtgaagggtacatatgagcct
ggaaagcggcactggctgaaagtcaagaaagactatttgaatgagggggccatggctgac
acagctgacctggtggtccttggggccttctatgggcaagggagcaaaggtggcatgatg
tccatcttcctcatgggctgctatgacccaggcagccagaagtggtgcacggtcaccaag
tgttcgggaggccatgatgatgcgacgcttgcccgcctacagaaggaactggacatggtg
aagatcagtaaggatcccagcaagatacccagctggctgaaaatcaacaagatctactac
ccggacttcatagttccagacccaaagaaagctgccgtgtgggagatcacaggggctgag
ttctccaaatctgaggctcacacggctgacggaatctccatccgattccctcgttgcacc
cggatccgtgatgataaggactggaaatctgccactgacctccccaaactcaaggaactg
taccagctgtccaaggagagggcagacttcactgtggcagccggagacgaggggagctcc
actactgggggtagcagcggagagaacgaggttacctcgcggcctgcctccagggcctcc
ccgaagcagccctccaccagtgccaagaaggcaggagggaggcggagcagccccaacagc
cgaggtggtagcaagcccacagcgaagcctccccccgtgagagtgggagagaagcggaag
gctcccgacgagcccccgggccaagcaaaggtgctgctggacatcttcactggggtgcgg
ctctacctgccaccctccacgccggacttcagccgtctcagacgctactttgtggcattc
gatggggacctggtgcaggaatttgacatggcttcggccacgcacgtgctggggagcagg
gacgagaaccctgaggcccagcgggtctccccggagtggatctgggcgtgtatccggaaa
cggaggctggtagctccctgctag

DBGET integrated database retrieval system