Felis catus (domestic cat): 101099760 Help Entry 101099760         CDS       T02385                                  Name (RefSeq) C-C motif chemokine 13   KO K16595   C-C motif chemokine 13 Organism fca  Felis catus (domestic cat) Pathway fca04060   Cytokine-cytokine receptor interaction fca04061   Viral protein interaction with cytokine and cytokine receptor fca04062   Chemokine signaling pathway fca04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101099760   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101099760    04061 Viral protein interaction with cytokine and cytokine receptor     101099760  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101099760  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     101099760    00536 Glycosaminoglycan binding proteins [BR:fca00536]     101099760 Cytokines and neuropeptides [BR:fca04052]  Cytokines   Chemokines    101099760 Glycosaminoglycan binding proteins [BR:fca00536]  Heparan sulfate / Heparin   Chemokines    101099760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  101099760 NCBI-ProteinID:  XP_003996618 EnsemblRapid:  ENSFCTG00005027712 UniProt:  M3X6S8 LinkDB All DBs Position E1:22091636..22093529 Genome browser AA seq 98 aa AA seqDB search MRVSAALLCLLLAAAAFSLQALAQPGAFSALFPCCFTFNNKKIPLPKLTTYRITSSHCPQ TAVIFRTKLAKEICADPKEKWVQEYVKQLSQKSRALKP NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagggtctccgcagcgcttctgtgcctgctgctggcagctgccgccttcagcctccag gcgctcgcccagccaggtgcattcagtgccctgttcccttgctgtttcacgtttaacaat aagaagatccccttgccgaagctgacgacctatcgaatcaccagcagccactgtccccag acagctgtcatcttcaggacgaagctggccaaggagatctgtgctgacccgaaggagaaa tgggtccaggagtatgtgaaacagctcagtcaaaaatctcgtgccctgaagccttga

DBGET integrated database retrieval system