KEGG   Felis catus (domestic cat): 101100682Help
Entry
101100682         CDS       T02385                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00500  Starch and sucrose metabolism
fca01100  Metabolic pathways
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04910  Insulin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
Module
fca_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101100682 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101100682 (GYS1)
   04152 AMPK signaling pathway
    101100682 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101100682 (GYS1)
   04922 Glucagon signaling pathway
    101100682 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101100682 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fca01003]
    101100682 (GYS1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101100682 (GYS1)
Glycosyltransferases [BR:fca01003]
 Polysaccharide
  Storage polysaccharide
   101100682 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101100682
NCBI-ProteinID: XP_003997571
Ensembl: ENSFCAG00000003349
LinkDB All DBs
Position
E2
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHIFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDVDGERYDEEEEAAKDRRNIRAPEWPRRASCASSTSGSKRGSVDTAPSSSIS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagccgcactttgtccatgtcctcactgccaggactggaggattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacggtgctacagacgaaggcgaaagtgacaggggatgaatggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccaaccccagccctgaagaggacgttggactccatgaacagcaagggctgcaag
gtgtatttcggacgctggctgatcgaggggggccccctggtggtgctcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacatcggg
gtgccttggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagaacgaggagaagccacacgtggttgcacacttccac
gagtggttggcgggcattggcctctgcctgtgccgggcccggcggctgcccgtggccaca
atcttcaccacccacgccacactgctgggacgctacctgtgtgccggtgccgtggacttc
tataacaacctggagaatttcaatgtggacaaggaagcaggggagaggcaaatctatcac
cgctactgcatggagcgggcagcggcccactgcgctcatatctttactactgtgtcccag
attactgccatcgaggctcagcacctgctcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtatttctttatcgccggccgctacgagttctctaacaagggggccgat
gtcttcctagaggccttggcccggctcaactatctactcagagtgaacggcagtgagcag
acagtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctc
aaaggccaagctgtgcgcaagcagctttgggatacggccaacaccgtgaaagagaagttc
ggaaggaagctttatgagtccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatatttgccacgcagcgacagtctttc
ccccctgtgtgcacccacaatatgctggacgactcctcggatcctatcctgaccaccatc
cgtcgaatcggactcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggattatgaggaatttgtccgtggctgc
cacctgggggtcttcccctcctactatgagccttggggctacacgccggctgagtgcacg
gttatgggcatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgttcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagagaaaccgcacggagcgcctctcagaccttctagactggaaatac
ctaggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacac
ttcacctatgagccccacgaggctgacgcgacccagggctaccgctaccctcggccggcc
tccgtgccgccatcaccctcgctgtcgcgacactcaagccctcaccagagcgaggacgag
gaggagccacgggacgggccgcccgacgtagacggggagcgctacgatgaggaagaggag
gccgccaaggaccggcgcaacatccgcgccccagagtggccgcgccgcgcctcctgcgcc
tcttccaccagcgggagcaagcgcggctccgtggacacagcgccctccagctcaatcagc
actcccagcgagcccctcagccccgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system