KEGG   Felis catus (domestic cat): 101100876
Entry
101100876         CDS       T02385                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101100876
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 101100876
NCBI-ProteinID: XP_019680776
LinkDB
Position
A2
AA seq 102 aa
MCPELSSSEEDSCVVSCSTDDDCPQGIRCCPRSPCSRSCVFPVMAPLQKAGRCPRVPVPL
APKPCSESTECSVDSQCAGSRKCCFSTCAMRCLDPATEDPLQ
NT seq 309 nt   +upstreamnt  +downstreamnt
atgtgcccggagctcagctcctcggaggaggactcctgcgtcgtctcctgcagcaccgat
gacgactgcccccaaggcatcagatgctgccccaggagcccctgcagccgctcctgcgtg
ttccccgtcatggcacctttgcaaaaggctggccgctgcccccgggtacccgtcccgctg
gcccccaagccctgctcagagagcaccgagtgctctgtggacagccagtgtgcagggagc
aggaagtgttgtttcagcacgtgcgccatgcggtgtctggaccctgcgacagaggacccc
cttcagtga

DBGET integrated database retrieval system