KEGG   Felis catus (domestic cat): 101101270Help
Entry
101101270         CDS       T02385                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00240  Pyrimidine metabolism
fca00983  Drug metabolism - other enzymes
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    101101270 (TK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101101270 (TK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101101270 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 101101270
NCBI-ProteinID: XP_003997286
Ensembl: ENSFCAG00000013007
UniProt: M3WI14
LinkDB All DBs
Position
E1
AA seq 237 aa AA seqDB search
MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
YSSSFSTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFSETMANAGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGAEKEVEVIGGADK
YHSVCRLCYFKKASGLPAGPDGKENKENCPLLGKPGEASGARKLFAPHQILQCSSAN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaacctgcccaccgtgctgcccggctcccccagcaagacccgggggcag
atccaggtgattctaggacccatgttctcgggaaaaagtactgagctgatgagacgggtc
cgtcgcttccagatcgcccagtacaagtgcttggtcatcaagtacgccaaagacactcgc
tatagcagcagcttctccacgcacgaccgaaacaccatggaggcactgccagcctgcctg
ctccgggatgtggcccaggaggccctaggcgtggctgtcataggcatcgacgaagggcag
tttttcccagacatcgtggagttcagcgagactatggccaacgccgggaagaccgtgatt
gtggctgcactggatgggaccttccagaggaaggccttcgggaccatcctgaacctggtg
cccctggcggagagtgttgtgaagctgacggcggtgtgcatggagtgcttccgcgaagcc
gcctataccaagaggctgggcgcggagaaggaggtcgaggtgatcgggggcgcagacaaa
taccactccgtgtgccgcctgtgctacttcaagaaggcctcgggtctgcccgccgggccg
gacggcaaggagaataaggagaactgcccgctgctggggaagccaggagaggcctcgggg
gcccgcaagctgtttgctccgcatcagatcctgcagtgcagctcggccaactga

DBGET integrated database retrieval system