KEGG   Felis catus (domestic cat): 101101686
Entry
101101686         CDS       T02385                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X2
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca03320  PPAR signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04510  Focal adhesion
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04931  Insulin resistance
fca04960  Aldosterone-regulated sodium reabsorption
fca05145  Toxoplasmosis
fca05205  Proteoglycans in cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05223  Non-small cell lung cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101101686 (PDPK1)
   04071 Sphingolipid signaling pathway
    101101686 (PDPK1)
   04151 PI3K-Akt signaling pathway
    101101686 (PDPK1)
   04152 AMPK signaling pathway
    101101686 (PDPK1)
   04150 mTOR signaling pathway
    101101686 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101101686 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    101101686 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101686 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101101686 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    101101686 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101101686 (PDPK1)
   03320 PPAR signaling pathway
    101101686 (PDPK1)
   04919 Thyroid hormone signaling pathway
    101101686 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101101686 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101101686 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101101686 (PDPK1)
   05231 Choline metabolism in cancer
    101101686 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101101686 (PDPK1)
   05213 Endometrial cancer
    101101686 (PDPK1)
   05223 Non-small cell lung cancer
    101101686 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101101686 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101101686 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101101686 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101101686 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101686 (PDPK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101101686 (PDPK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   101101686 (PDPK1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    101101686 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 101101686
NCBI-ProteinID: XP_011288988
Ensembl: ENSFCAG00000001964
UniProt: M3VXM6
LinkDB
Position
E3
AA seq 558 aa
MARTTSQLYDTVPIQSSVVLCSCPSPSMVRTQTESGSAPGIPSGGSRQGSTMDSTAAESR
SSANSLQHTTQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI
IKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFD
ETCTRFYTAEMVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQAR
ANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLE
YDFPEKFFPKARDLVEKLLVLDATKRLGCEEMGGYGPLQAHPFFESISWENLQHQTPPKL
TAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSTSSSSHCLPASDAGLPPAAGSNIEQYIHD
LDTNSFELDLQFSQDEKRLLLEKQASGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLL
TEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKK
IQEVWRHRYQSHPDAAVQ
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacacggttcctattcagtccagcgtggtgtta
tgttcttgcccgtccccatcaatggtgaggacccagactgagtccggctcggcccctggc
attcccagtggtggtagcagacagggctccaccatggacagcaccgcggctgagtcccga
tcgagcgccaactcgctgcagcacaccacacagccaccgccacagcctcggaagaaacgg
cccgaagacttcaaatttgggaaaattcttggtgaaggctctttctcaacagttgtcctg
gcccgagaactggcaacctcaagggaatacgctattaaaattctagagaaacgtcacatt
atcaaagagaacaaggtcccgtatgtaaccagagagagagacgtgatgtcacgcctggat
cacccgttctttgttaaactttacttcacatttcaggatgatgaaaagctgtactttggt
cttagttatgccaaaaatggagaactacttaaatacattcgcaaaattggctcattcgat
gagacgtgcacccggttttacacggccgagatggtgtcggctctggagtacttgcatggc
aagggcatcattcacagggacctgaaaccagaaaacattttgttaaatgaagacatgcac
atccagatcacagattttggaacagcgaaagtcttatccccggagagtaaacaagccagg
gccaactcgtttgtaggaacagcccagtatgtgtctccagagctgctcacagagaaatcg
gcctgtaaaagttcggacctttgggctctcggatgtataatatatcagcttgtggcagga
ctgccgccttttcgagcgggaaatgaatatcttatatttcagaagatcattaagctggaa
tatgactttcctgaaaaattcttccctaaggcaagagaccttgtggaaaaacttttggtt
ttagatgccacgaagcgattaggctgcgaggaaatgggagggtacggccctctgcaggct
caccccttcttcgagtccatctcgtgggaaaacctgcagcatcagacgcctccaaagctc
accgcttacctgccggccatgtcggaagatgacgaggactgctacgggaattacgacaac
ctcctgagccagtttggctgcatgcaagtgtccacgtcctcgtcgtcacactgcctgccc
gcctcagacgcaggcctgccgccagcggcgggcagcaacatcgagcagtacatccatgac
ctggacactaactcttttgagctggacctccagttttcccaagacgagaagaggctcctg
ctggagaagcaggccagcggcaatccttggcaccagtttgtagaaaataacttgatacta
aagatgggtccggtagataagcgaaagggcttgtttgcacgacgacgacagctactgctc
acagaagggccacacttgtattatgtggatcctgtcaacaaagtcctgaagggcgaaatt
ccgtggtcacaagaactccgaccggaggccaagaactttaaaaccttctttgtccacacg
ccgaacaggacgtattacctgatggacccgagtgggaatgctcacaaatggtgcaaaaag
atccaggaagtgtggagacacaggtaccagagccacccggacgccgccgtgcagtga

DBGET integrated database retrieval system