KEGG   Felis catus (domestic cat): 105261394
Entry
105261394         CDS       T02385                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105261394 (IL3RA)
   04151 PI3K-Akt signaling pathway
    105261394 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105261394 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105261394 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105261394 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105261394 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    105261394 (IL3RA)
   04090 CD molecules [BR:fca04090]
    105261394 (IL3RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   105261394 (IL3RA)
CD molecules [BR:fca04090]
 Proteins
  105261394 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 105261394
NCBI-ProteinID: XP_023104654
LinkDB
Position
X
AA seq 395 aa
MAFLWLALCLTPACCLLHKDEDPEPPIKNLRMQPETRRLTWDLSGNVSEISCFINSRLIT
KAVDKPYCQFRVLPTCQVTNFTVASTGDPPFSAGILYPRPEGHPEAAAQRLGCWVHDVDF
LTCSWEAGRAAPGDVQYRLYWQDLKTYEEEECPRYGVDDRGTHIRCHFDDVSRLREHVQF
LVKGTSRGARIPCSDLTVELARIERLSLPNITGMCNKSYSIMEWKMSSHFNHRFTYELEI
QKGSDPAYTEKAPGSYFVLPNPGNYAVRLRAHARFRQTWSEWSAVRRFGLGSFQEEKLRT
QTRAEGRPECDLGKDTHFRDWLTSALIPLGALLALGLGVALCRRYSVLQKLFPPIPHLKD
PISDNLHSSKLVAWEASRASREDCQVAEVQVLGET
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggccttcctgtggctggccttgtgtctcacgcccgcgtgctgtctgctgcacaaggac
gaagatcccgagccgccgattaagaacctgcgaatgcagcccgagacgagaaggttgacc
tgggacctcagcggaaacgtgtctgagatcagctgtttcatcaactcgaggctgatcact
aaggccgtggacaagccttactgccagttccgcgtacttcccacgtgtcaggtgacgaat
ttcacggtcgcctccaccggagacccgccgttctccgcagggatcctgtaccccaggcca
gagggccaccctgaggcggccgcgcagcgtctgggctgctgggtgcacgacgtggacttc
ctgacgtgcagctgggaggcgggccgcgcggcccccggtgacgtccagtatcgcctgtac
tggcaggacctcaagacctacgaggaggaggagtgtccccggtacggggtggacgatcgg
gggacacacatccggtgtcatttcgacgacgtgtcccggctcagggaacacgtccagttc
ctggtgaagggcaccagcaggggcgcgaggatcccctgctccgacctcactgtggaactg
gcaagaatcgagagattaagtctgcccaacatcaccggaatgtgtaataaatcctattca
atcatggagtggaaaatgtcaagccactttaatcacagatttacatacgaacttgaaata
caaaagggctcagatcccgcctacaccgagaaggcgcccggcagctacttcgtgctcccc
aatcccggaaactacgcggtgaggctgagggcgcacgcgcgcttccgccaaacctggagc
gagtggagcgccgtccggcgctttggactggggtcctttcaagaagagaagttgaggaca
cagacacgcgcagagggacggccagagtgcgacctcgggaaggacacgcacttccgagac
tggctgacctccgctctgatcccgctgggcgcgctgctggccctggggctgggggtcgcg
ctgtgccgaaggtactcggtgctgcagaagctcttccccccgatcccgcacctgaaggac
cccatcagtgacaacctgcacagcagcaagttggtggcctgggaggccagcagagcaagc
cgggaggactgccaggtggcggaggtgcaggttctgggagaaacgtga

DBGET integrated database retrieval system