KEGG   Felis catus (domestic cat): 111559549
Entry
111559549         CDS       T02385                                 

Definition
(RefSeq) uncharacterized protein LOC111559549
  KO
K10785  T-cell receptor beta chain V region
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05135  Yersinia infection
fca05142  Chagas disease
fca05144  Malaria
fca05150  Staphylococcus aureus infection
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05202  Transcriptional misregulation in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111559549
   04015 Rap1 signaling pathway
    111559549
   04064 NF-kappa B signaling pathway
    111559549
   04020 Calcium signaling pathway
    111559549
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111559549
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111559549
   04660 T cell receptor signaling pathway
    111559549
   04658 Th1 and Th2 cell differentiation
    111559549
   04659 Th17 cell differentiation
    111559549
   04672 Intestinal immune network for IgA production
    111559549
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111559549
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111559549
  09163 Immune disease
   05310 Asthma
    111559549
   05322 Systemic lupus erythematosus
    111559549
   05323 Rheumatoid arthritis
    111559549
   05320 Autoimmune thyroid disease
    111559549
   05321 Inflammatory bowel disease
    111559549
   05330 Allograft rejection
    111559549
   05332 Graft-versus-host disease
    111559549
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111559549
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111559549
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111559549
   05150 Staphylococcus aureus infection
    111559549
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111559549
   05170 Human immunodeficiency virus 1 infection
    111559549
   05162 Measles
    111559549
   05169 Epstein-Barr virus infection
    111559549
  09174 Infectious disease: parasitic
   05144 Malaria
    111559549
   05142 Chagas disease
    111559549
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 5HT_transport_N
Other DBs
NCBI-GeneID: 111559549
NCBI-ProteinID: XP_023106410
LinkDB
Position
A2
AA seq 247 aa
MSLGLLCCVALGLLQAGPVNAGITQTPAFQILGAGHSMTLRCEQDKDHDYMSWYRQDPGH
GLRLIHYSVSAGTTERGEISNGYNVSRSNTKNFPLTLTSATPSQTSVYFCASSDYTALHS
CLLSAQKKAGGGPAPRDSAEPSAHSQPPRPDPSPRAPRGPSAQSEPRCGLRSVCKALTAW
PGPDQTSGGHVSTSGLCSEPPGWLRRCFPSSDCSTPCLSLMLPGWKLFALGKQHNVLLTM
CYEIRSI
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagcctcggcctcctgtgctgtgtggccctgggtctcctgcaggcagggcccgtgaat
gctggcatcactcagacccccgcattccagatcctgggggcaggacacagcatgacgctg
agatgtgaacaggacaaggaccacgactacatgtcctggtatcgacaagaccctggacat
gggctgcggctgatccattactccgtcagtgctggtaccaccgagagaggagaaatctcc
aacggatacaacgtctctaggtcaaatacaaagaacttccctctcacgctgacgtctgca
actccctcccagacatctgtgtacttctgtgccagcagtgactacacagcgctgcacagc
tgtctcctctctgcacaaaaaaaggcagggggagggcctgcgccccgggactcggcagag
ccctcggcacactcccagcccccccgccccgacccgagccccagagccccgaggggccca
agcgcccagagtgaacctcggtgtgggctgaggtccgtctgcaaggcactgacagcctgg
cctggacccgaccagacctcaggcggccatgtctccacctctggtctgtgctctgagccg
cctggctggctgcgaaggtgcttccccagctctgactgttctaccccctgcctaagtctg
atgcttccgggatggaaattgttcgcactgggtaaacagcacaatgtgttattaacaatg
tgttatgaaatcagatctatctag

DBGET integrated database retrieval system